SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.18g281100

Feature Type:gene_model
Chromosome:Gm18
Start:56206467
stop:56208314
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G29540.1AT RNApolymerase 14 kDa subunit JGI N/AIEA
GO:0006351GO-bp transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006351GO-bp transcription, DNA-templated JGI N/AIEA
GO:0006360GO-bp transcription by RNA polymerase I EnsemblGenomesN/AIEA
GO:0006383GO-bp transcription by RNA polymerase III EnsemblGenomesN/AIEA
GO:0005666GO-cc DNA-directed RNA polymerase III complex EnsemblGenomesN/AIEA
GO:0005736GO-cc DNA-directed RNA polymerase I complex EnsemblGenomesN/AIEA
GO:0001054GO-mf RNA polymerase I activity EnsemblGenomesN/AIEA
GO:0001056GO-mf RNA polymerase III activity EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding EnsemblGenomesN/AIEA
GO:0003899GO-mf DNA-directed 5'-3' RNA polymerase activity EnsemblGenomesN/AIEA
GO:0046983GO-mf protein dimerization activity EnsemblGenomesN/AIEA
GO:0046983GO-mf protein dimerization activity JGI N/AIEA
KOG3438 KOG DNA-directed RNA polymerase, subunit L JGI N/AIEA
PTHR13946Panther DNA-DIRECTED RNA POLYMERASE I,II,III JGI N/AIEA
PF01193PFAM RNA polymerase Rpb3/Rpb11 dimerisation domain JGI N/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g281100 not represented in the dataset

Glyma.18g281100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma18g51643 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.18g281100.1 sequence-type=CDS polypeptide=Glyma.18g281100.1.p locus=Glyma.18g281100 ID=Glyma.18g281100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATATATCTTGTTGTTCCCTTCCCAGTTCCTAGCCCTTCGCCGCCGCAGCATCCGAATTCCTTTGATCGTTGGTGTGGAGCGATGGAACACGGCTCATACACTGATCAGAGTAAATCAACATTTAGTCTCGTAGATGAGGATCATACTTTTGCAAACGCTGTTAGATTCACCTTAAATCAAGACCCAAGAGTGTCATTTTGTGGCTACAGCATTCCTCATCCTTCAGATAATCGTGTTAATATCAGAGTCCAGACAACAGGCGATCCATCACGCGAGGTGTTAAAAGATGCATGTCAAGATCTGATGCTTATGTGCCAGCATGTTAGGAGCACTTTTGATAAGGCAGTCAGTGATTTTAAAATCAGCAAGGCTAGGAAGAATAATGAGGATATGGATGTCGAGTAA

>Glyma.18g281100.1.p sequence-type=predicted peptide transcript=Glyma.18g281100.1 locus=Glyma.18g281100 ID=Glyma.18g281100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MIYLVVPFPVPSPSPPQHPNSFDRWCGAMEHGSYTDQSKSTFSLVDEDHTFANAVRFTLNQDPRVSFCGYSIPHPSDNRVNIRVQTTGDPSREVLKDACQDLMLMCQHVRSTFDKAVSDFKISKARKNNEDMDVE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo