|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G36130.1 | AT | Cytochrome P450 superfamily protein | JGI | N/A | IEA |
| GO:0007275 | GO-bp | multicellular organism development | EnsemblGenomes | N/A | IEA |
| GO:0010268 | GO-bp | brassinosteroid homeostasis | EnsemblGenomes | N/A | IEA |
| GO:0016125 | GO-bp | sterol metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0016132 | GO-bp | brassinosteroid biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0004497 | GO-mf | monooxygenase activity | EnsemblGenomes | N/A | IEA |
| GO:0005506 | GO-mf | iron ion binding | EnsemblGenomes | N/A | IEA |
| GO:0016705 | GO-mf | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | EnsemblGenomes | N/A | IEA |
| GO:0020037 | GO-mf | heme binding | EnsemblGenomes | N/A | IEA |
| GN7V-65518 | SoyCyc9-rxn | β-amyrin 28-oxidase | Plant Metabolic Network | ISS |
|
Glyma.18g265600 not represented in the dataset |
Glyma.18g265600 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma18g50051 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.18g265600.1 sequence-type=CDS polypeptide=Glyma.18g265600.1.p locus=Glyma.18g265600 ID=Glyma.18g265600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAAATATTCGTGGAATATATCCCAAGGAGCTTTTAGGGAAGCTATAGAGGACTTTGACTTCAATGGATTCTCAATTCCAAAAGCCTGGAAGTTCAACACTCAGAAATCCAGAGTACTTCCCCCAGAGCCAGAGAAATTTGATCCGAGAAGATTAGAAGGAAATGAACCAGCTCCGTATACTTATGTGCCATTTGTGAAGAGGTTCAAGTGTCAAACTGTTATTCCTAATGGGAATATTACGTACAATCCCACGCCTATTCCTGCCAAGGGCCTTCCTGTTCGTCTTATTCCTCAACGATCTTGA
>Glyma.18g265600.1.p sequence-type=predicted peptide transcript=Glyma.18g265600.1 locus=Glyma.18g265600 ID=Glyma.18g265600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MKYSWNISQGAFREAIEDFDFNGFSIPKAWKFNTQKSRVLPPEPEKFDPRRLEGNEPAPYTYVPFVKRFKCQTVIPNGNITYNPTPIPAKGLPVRLIPQRS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||