SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.18g258800

Feature Type:gene_model
Chromosome:Gm18
Start:54427360
stop:54427611
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g258800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60460.1AT Preprotein translocase Sec, Sec61-beta subunit protein JGI N/AIEA
GO:0006616GO-bp SRP-dependent cotranslational protein targeting to membrane, translocation EnsemblGenomesN/AIEA
GO:0006886GO-bp intracellular protein transport EnsemblGenomesN/AIEA
GO:0031204GO-bp posttranslational protein targeting to membrane, translocation EnsemblGenomesN/AIEA
GO:0065009GO-bp regulation of molecular function EnsemblGenomesN/AIEA
GO:0005784GO-cc Sec61 translocon complex EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0031205GO-cc endoplasmic reticulum Sec complex EnsemblGenomesN/AIEA
GO:0005086GO-mf ARF guanyl-nucleotide exchange factor activity EnsemblGenomesN/AIEA
GO:0015450GO-mf P-P-bond-hydrolysis-driven protein transmembrane transporter activity EnsemblGenomesN/AIEA
KOG3457 KOG Sec61 protein translocation complex, beta subunit JGI N/AIEA
PTHR13509Panther SEC61BETA-PROV PROTEIN JGI N/AIEA
PF03911PFAM Sec61beta family JGI N/AIEA

Expression Patterns of Glyma.18g258800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.18g258800 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g49330 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g258800
>Glyma.18g258800.1 sequence-type=CDS polypeptide=Glyma.18g258800.1.p locus=Glyma.18g258800 ID=Glyma.18g258800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTCCCCGCAGTTCTGCCGCCGCCACTGCCGACATGCGTCGCTGCCGTCTCGATGGCAGAAACAACTCTACCAGCATCGGCATTGGAGGCAGCAACAACAACATGCTGAGGTTCTACACGGATGACGCCACGAGGCCGAAGATTTTGCCGACGATGGTGCTCGCGATGAGCCTCTGCTTCATCGGCTTCGTCACCGCGCTCCACATGTTCGGCAAACTCTACCGCTCCAAATCTGGTGGCGCCATTTGA
Predicted protein sequences of Glyma.18g258800
>Glyma.18g258800.1.p sequence-type=predicted peptide transcript=Glyma.18g258800.1 locus=Glyma.18g258800 ID=Glyma.18g258800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAPRSSAAATADMRRCRLDGRNNSTSIGIGGSNNNMLRFYTDDATRPKILPTMVLAMSLCFIGFVTALHMFGKLYRSKSGGAI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo