|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G60460.1 | AT | Preprotein translocase Sec, Sec61-beta subunit protein | JGI | N/A | IEA |
GO:0006616 | GO-bp | SRP-dependent cotranslational protein targeting to membrane, translocation | EnsemblGenomes | N/A | IEA |
GO:0006886 | GO-bp | intracellular protein transport | EnsemblGenomes | N/A | IEA |
GO:0031204 | GO-bp | posttranslational protein targeting to membrane, translocation | EnsemblGenomes | N/A | IEA |
GO:0065009 | GO-bp | regulation of molecular function | EnsemblGenomes | N/A | IEA |
GO:0005784 | GO-cc | Sec61 translocon complex | EnsemblGenomes | N/A | IEA |
GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
GO:0031205 | GO-cc | endoplasmic reticulum Sec complex | EnsemblGenomes | N/A | IEA |
GO:0005086 | GO-mf | ARF guanyl-nucleotide exchange factor activity | EnsemblGenomes | N/A | IEA |
GO:0015450 | GO-mf | P-P-bond-hydrolysis-driven protein transmembrane transporter activity | EnsemblGenomes | N/A | IEA |
KOG3457 | KOG | Sec61 protein translocation complex, beta subunit | JGI | N/A | IEA |
PTHR13509 | Panther | SEC61BETA-PROV PROTEIN | JGI | N/A | IEA |
PF03911 | PFAM | Sec61beta family | JGI | N/A | IEA |
Glyma.18g258800 not represented in the dataset |
Glyma.18g258800 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma18g49330 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.18g258800.1 sequence-type=CDS polypeptide=Glyma.18g258800.1.p locus=Glyma.18g258800 ID=Glyma.18g258800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTCCCCGCAGTTCTGCCGCCGCCACTGCCGACATGCGTCGCTGCCGTCTCGATGGCAGAAACAACTCTACCAGCATCGGCATTGGAGGCAGCAACAACAACATGCTGAGGTTCTACACGGATGACGCCACGAGGCCGAAGATTTTGCCGACGATGGTGCTCGCGATGAGCCTCTGCTTCATCGGCTTCGTCACCGCGCTCCACATGTTCGGCAAACTCTACCGCTCCAAATCTGGTGGCGCCATTTGA
>Glyma.18g258800.1.p sequence-type=predicted peptide transcript=Glyma.18g258800.1 locus=Glyma.18g258800 ID=Glyma.18g258800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAPRSSAAATADMRRCRLDGRNNSTSIGIGGSNNNMLRFYTDDATRPKILPTMVLAMSLCFIGFVTALHMFGKLYRSKSGGAI*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||