SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.18g246300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.18g246300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.18g246300

Feature Type:gene_model
Chromosome:Gm18
Start:53381472
stop:53384215
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g246300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G10040.1AT cytochrome c-2 JGI N/AIEA
GO:0006122GO-bp mitochondrial electron transport, ubiquinol to cytochrome c EnsemblGenomesN/AIEA
GO:0006123GO-bp mitochondrial electron transport, cytochrome c to oxygen EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0005739GO-cc mitochondrion EnsemblGenomesN/AIEA
GO:0005758GO-cc mitochondrial intermembrane space EnsemblGenomesN/AIEA
GO:0070469GO-cc respiratory chain EnsemblGenomesN/AIEA
GO:0005506GO-mf iron ion binding JGI N/AIEA
GO:0009055GO-mf electron transfer activity EnsemblGenomesN/AIEA
GO:0009055GO-mf electron carrier activity JGI N/AIEA
GO:0020037GO-mf heme binding EnsemblGenomesN/AIEA
GO:0020037GO-mf heme binding JGI N/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
KOG3453 KOG Cytochrome c JGI N/AIEA
PTHR11961Panther CYTOCHROME C JGI N/AIEA
PF00034PFAM Cytochrome c JGI N/AIEA

Expression Patterns of Glyma.18g246300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g246300 not represented in the dataset
Glyma.18g246300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.18g246300
ParalogEvidenceComments
Glyma.09g246700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.18g246300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g48160 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g246300
>Glyma.18g246300.1 sequence-type=CDS polypeptide=Glyma.18g246300.1.p locus=Glyma.18g246300 ID=Glyma.18g246300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGTCGTTCGAAGAAGCTCCTCCCGGAAACTCCAAGAACGGCGAGAAGATCTTCAAGACCAAGTGCGCTCAGTGCCACACCGTGGACAAAGGTGCCGGTCACAAACAAGGACCCAATCTGAATGGTTTGTTTGGAAGGCAATCTGGCACAACTCCTGGATATTCCTATTCTACTGCTAACAAAAACATGGCTGTGATTTGGGAGGAAAAGACCTTGTATGATTACTTGCTCAACCCCAAAAAGTATATTCCAGGGACAAAGATGGTGTTTCCCGGTCTTAAGAAACCTCAGGAACGTGCAGATCTTATTGCATATCTTAAAGAATCCACTGCATAA
Predicted protein sequences of Glyma.18g246300
>Glyma.18g246300.1.p sequence-type=predicted peptide transcript=Glyma.18g246300.1 locus=Glyma.18g246300 ID=Glyma.18g246300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASFEEAPPGNSKNGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTANKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKESTA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo