SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.18g227700

Feature Type:gene_model
Chromosome:Gm18
Start:51687486
stop:51689946
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g227700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G03550.1AT RING/U-box superfamily protein JGI N/AIEA
GO:0016567GO-bp protein ubiquitination EnsemblGenomesN/AIEA
GO:0043161GO-bp proteasome-mediated ubiquitin-dependent protein catabolic process EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0005515GO-mf protein binding JGI N/AIEA
GO:0008270GO-mf zinc ion binding JGI N/AIEA
GO:0046872GO-mf metal ion binding JGI N/AIEA
GO:0061630GO-mf ubiquitin protein ligase activity EnsemblGenomesN/AIEA
PTHR14155Panther RING FINGER DOMAIN-CONTAINING JGI N/AIEA
PTHR14155:SF2Panther GH10160P JGI N/AIEA
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI N/AIEA

Expression Patterns of Glyma.18g227700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g227700 not represented in the dataset
Glyma.18g227700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.18g227700
ParalogEvidenceComments
Glyma.09g264300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.18g227700 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g46201 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g227700
>Glyma.18g227700.1 sequence-type=CDS polypeptide=Glyma.18g227700.1.p locus=Glyma.18g227700 ID=Glyma.18g227700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTTGGGTTCAGGTACCAATTTGGTGACCACGGTCATTGGGTTTGGGATGAGTGCCACTTTCATTGTGTTTGTGTGCACCAGAATCATTTGTGGGAGGCTAAGAGGGGGTGTTGAATCTCGGATGATGTACGAGATTGAATCAAGAATTGATATGGAACAGCCAGAACATCATGTTAATGACCCTGAATCCGATCCTGTTCTTCTTGATGCAATCCCTACTTTGAAGTTCAACCAAGAGGCTTTCAGTTCCCTTGAACACACACAGTGTGTAATATGTTTGGCAGATTACAGAGAAAGAGAAGTATTGCGCATCATGCCCAAATGTGGCCACACTTTTCATCTTTCTTGCATTGATATATGGCTGAGGAAACAATCCACCTGTCCAGTATGCCGTCTGCCGTTGAAAAACTCTTCCGAAACGAAACATGTGAGACCTGTGACATTTACCATGAGCCAATCCCTTGACGAGTCTCACACATCAGACAGAAACGATGATATTGAGAGATATGTTGAACCTACACCTACTGCAGCCAGTAACTCTTTACAACCAACTTCAGGAGAACAAGAAGCAAGGCAATGA
Predicted protein sequences of Glyma.18g227700
>Glyma.18g227700.1.p sequence-type=predicted peptide transcript=Glyma.18g227700.1 locus=Glyma.18g227700 ID=Glyma.18g227700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLGSGTNLVTTVIGFGMSATFIVFVCTRIICGRLRGGVESRMMYEIESRIDMEQPEHHVNDPESDPVLLDAIPTLKFNQEAFSSLEHTQCVICLADYREREVLRIMPKCGHTFHLSCIDIWLRKQSTCPVCRLPLKNSSETKHVRPVTFTMSQSLDESHTSDRNDDIERYVEPTPTAASNSLQPTSGEQEARQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo