|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G52360.2 | AT | Coatomer, beta' subunit | JGI | N/A | IEA |
GO:0006886 | GO-bp | intracellular protein transport | EnsemblGenomes | N/A | IEA |
GO:0006888 | GO-bp | ER to Golgi vesicle-mediated transport | EnsemblGenomes | N/A | IEA |
GO:0006890 | GO-bp | retrograde vesicle-mediated transport, Golgi to ER | EnsemblGenomes | N/A | IEA |
GO:0006891 | GO-bp | intra-Golgi vesicle-mediated transport | EnsemblGenomes | N/A | IEA |
GO:0030126 | GO-cc | COPI vesicle coat | EnsemblGenomes | N/A | IEA |
GO:0005515 | GO-mf | protein binding | EnsemblGenomes | N/A | IEA |
GO:0005515 | GO-mf | protein binding | JGI | N/A | IEA |
PTHR19876 | Panther | COATOMER | JGI | N/A | IEA |
PTHR19876:SF2 | Panther | COATOMER SUBUNIT BETA' | JGI | N/A | IEA |
PF00400 | PFAM | WD domain, G-beta repeat | JGI | N/A | IEA |
Glyma.18g179100 not represented in the dataset |
Glyma.18g179100 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma18g39481 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.18g179100.1 sequence-type=CDS polypeptide=Glyma.18g179100.1.p locus=Glyma.18g179100 ID=Glyma.18g179100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCCAATAAAACCTTTGAAACAAGTATGGGATTATCAAACCAAAAGTTATGTTCAGACTCTAAAAGGTCACACACAATATGTATATGTTGTATGCTTTGATCCTGAACCATCTATAATCATTACTGGCTCTGAGGATGGCACAATGCGCATTTGGCATTCAACAACTTATAGGCATGAGAACACATTGAACTATGTTCTTCAAAGAGTTTGGGCACAGGTACGTTGCATAGATCTTTAA
>Glyma.18g179100.1.p sequence-type=predicted peptide transcript=Glyma.18g179100.1 locus=Glyma.18g179100 ID=Glyma.18g179100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MPIKPLKQVWDYQTKSYVQTLKGHTQYVYVVCFDPEPSIIITGSEDGTMRIWHSTTYRHENTLNYVLQRVWAQVRCIDL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||