SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.18g163400

Feature Type:gene_model
Chromosome:Gm18
Start:37282034
stop:37282711
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g163400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G62950.1AT RNA polymerase II, Rpb4, core protein JGI N/AIEA
GO:0006351GO-bp transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006351GO-bp transcription, DNA-templated JGI N/AIEA
GO:0006352GO-bp DNA-templated transcription, initiation EnsemblGenomesN/AIEA
GO:0006384GO-bp transcription initiation from RNA polymerase III promoter EnsemblGenomesN/AIEA
GO:0044237GO-bp cellular metabolic process EnsemblGenomesN/AIEA
GO:0005666GO-cc DNA-directed RNA polymerase III complex EnsemblGenomesN/AIEA
GO:0030880GO-cc RNA polymerase complex EnsemblGenomesN/AIEA
GO:0055029GO-cc nuclear DNA-directed RNA polymerase complex EnsemblGenomesN/AIEA
GO:0000166GO-mf nucleotide binding EnsemblGenomesN/AIEA
GO:0001056GO-mf RNA polymerase III activity EnsemblGenomesN/AIEA
GO:0003824GO-mf catalytic activity EnsemblGenomesN/AIEA
GO:0003899GO-mf DNA-directed 5'-3' RNA polymerase activity EnsemblGenomesN/AIEA
GO:0003899GO-mf DNA-directed RNA polymerase activity JGI N/AIEA
PTHR15561Panther CALCITONIN GENE-RELATED PEPTIDE-RECEPTOR COMPONENT PROTEIN JGI N/AIEA
PF03874PFAM RNA polymerase Rpb4 JGI N/AIEA

Expression Patterns of Glyma.18g163400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g163400 not represented in the dataset
Glyma.18g163400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.18g163400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g34321 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g163400
>Glyma.18g163400.1 sequence-type=CDS polypeptide=Glyma.18g163400.1.p locus=Glyma.18g163400 ID=Glyma.18g163400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTGTGTTAAAGTTCTTTGTCACAGCTTAGAGGGCAATGCTGGTGCACTCACAAATTTTGAGGTCCTTCATTTCTTACGAGCTAAAGGAGCTTCAAAGGATCCAACAAGAGTTAATGCCAAAGTAGCGCAGTTTGAATACAAGGTTTATGATTATTTGGTTGACACTGCTGCTTCAATTCAAACAAGAGAGAGCATCAATGAGTTATTGACAAGTGTTAAACAGCATGACCTGGCAAAAACTGAAGTTCTGAACATATTAAACATTGGACTAGCTGCTGATTTTGAACTATACCCAGTACGTATCAAAATTTTGATTTTCCAATTTATGTTACACATAAGCATTTAG
Predicted protein sequences of Glyma.18g163400
>Glyma.18g163400.1.p sequence-type=predicted peptide transcript=Glyma.18g163400.1 locus=Glyma.18g163400 ID=Glyma.18g163400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MCVKVLCHSLEGNAGALTNFEVLHFLRAKGASKDPTRVNAKVAQFEYKVYDYLVDTAASIQTRESINELLTSVKQHDLAKTEVLNILNIGLAADFELYPVRIKILIFQFMLHISI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo