|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G20420.1 | AT | ATP citrate lyase (ACL) family protein | JGI | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
| PTHR11815 | Panther | SUCCINYL-COA SYNTHETASE BETA CHAIN | JGI | N/A | IEA |
| PF08442 | PFAM | ATP-grasp domain | JGI | N/A | IEA |
| PWY-5464 | SoyCyc9 | superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle | Plant Metabolic Network | ISS | |
| PWY-5690 | SoyCyc9 | TCA cycle II (plants and fungi) | Plant Metabolic Network | ISS | |
| GN7V-64990 | SoyCyc9-rxn | succinate-CoA ligase (ADP-forming) | Plant Metabolic Network | ISS |
|
Glyma.18g157500 not represented in the dataset |
Glyma.18g157500 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma18g32712 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.18g157500.1 sequence-type=CDS polypeptide=Glyma.18g157500.1.p locus=Glyma.18g157500 ID=Glyma.18g157500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCTTGGGCAGATACTAGTTACCAAACAGACTGGTCCTCAGGGAAAAATAGTTAGCAAGGTTTACTTGTGTGCAAAGCTGGATGTAGTAAATGAGATGTACTTTGCTATATATAACACTGGATCGTACGAGTGCTGGTCCAGAACTTCTATCTTCAGAAACTTCCTCCCTTGGTGGTTCATAGGCTGGGTTGGGACCCCTAGCTAG
>Glyma.18g157500.1.p sequence-type=predicted peptide transcript=Glyma.18g157500.1 locus=Glyma.18g157500 ID=Glyma.18g157500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MLGQILVTKQTGPQGKIVSKVYLCAKLDVVNEMYFAIYNTGSYECWSRTSIFRNFLPWWFIGWVGTPS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||