SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.18g156300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.18g156300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.18g156300

Feature Type:gene_model
Chromosome:Gm18
Start:34235189
stop:34252546
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g156300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G49100.1AT Signal recognition particle, SRP9/SRP14 subunit JGI N/AIEA
GO:0006614GO-bp SRP-dependent cotranslational protein targeting to membrane EnsemblGenomesN/AIEA
GO:0006616GO-bp SRP-dependent cotranslational protein targeting to membrane, translocation EnsemblGenomesN/AIEA
GO:0045900GO-bp negative regulation of translational elongation EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0005785GO-cc signal recognition particle receptor complex EnsemblGenomesN/AIEA
GO:0005786GO-cc signal recognition particle, endoplasmic reticulum targeting EnsemblGenomesN/AIEA
GO:0048500GO-cc signal recognition particle EnsemblGenomesN/AIEA
GO:0003723GO-mf RNA binding EnsemblGenomesN/AIEA
GO:0005047GO-mf signal recognition particle binding EnsemblGenomesN/AIEA
GO:0008312GO-mf 7S RNA binding EnsemblGenomesN/AIEA
KOG3465 KOG Signal recognition particle, subunit Srp9 JGI N/AIEA
PTHR12834Panther SIGNAL RECOGNITION PARTICLE 9 KDA PROTEIN JGI N/AIEA
PTHR12834:SF1Panther JGI N/AIEA
PF05486PFAM Signal recognition particle 9 kDa protein (SRP9) JGI N/AIEA

Expression Patterns of Glyma.18g156300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g156300 not represented in the dataset
Glyma.18g156300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.18g156300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g31665 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g156300
>Glyma.18g156300.1 sequence-type=CDS polypeptide=Glyma.18g156300.1.p locus=Glyma.18g156300 ID=Glyma.18g156300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTTTATATAACTGAGTGGGACAAGTTTGTGGAGCAATCCATTGAGCTGTTCCGTGCAGATCCTGATTCTACACGGTACGTCATGAAGTACAGGCACTGTGATGGAAAGTTGGTACTCAAGGTCACTGATAACCAACAGTGTCTAAAGTATAAGACAGACCAAGCACAAGAGGCTAAGAAAATGGAGAAACTGAATAATATGTTCTTTGCTTTGATGGCTCGTGGTCCTGATGTTGATCTATCAGAAGTCACTGGAAAAGAGCAAATGGATGCTCAGCCAACCAAGAAAGGAAGAGGAAGGAAGCAATAA
Predicted protein sequences of Glyma.18g156300
>Glyma.18g156300.1.p sequence-type=predicted peptide transcript=Glyma.18g156300.1 locus=Glyma.18g156300 ID=Glyma.18g156300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVYITEWDKFVEQSIELFRADPDSTRYVMKYRHCDGKLVLKVTDNQQCLKYKTDQAQEAKKMEKLNNMFFALMARGPDVDLSEVTGKEQMDAQPTKKGRGRKQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo