SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.18g146900

Feature Type:gene_model
Chromosome:Gm18
Start:24896188
stop:24899934
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g146900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10480.1AT Protein-tyrosine phosphatase-like, PTPLA JGI N/AIEA
GO:0006629GO-bp lipid metabolic process EnsemblGenomesN/AIEA
GO:0006631GO-bp fatty acid metabolic process EnsemblGenomesN/AIEA
GO:0006633GO-bp fatty acid biosynthetic process EnsemblGenomesN/AIEA
GO:0030148GO-bp sphingolipid biosynthetic process EnsemblGenomesN/AIEA
GO:0030497GO-bp fatty acid elongation EnsemblGenomesN/AIEA
GO:0042761GO-bp very long-chain fatty acid biosynthetic process EnsemblGenomesN/AIEA
GO:0005783GO-cc endoplasmic reticulum EnsemblGenomesN/AIEA
GO:0005789GO-cc endoplasmic reticulum membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0030176GO-cc integral component of endoplasmic reticulum membrane EnsemblGenomesN/AIEA
GO:0016829GO-mf lyase activity EnsemblGenomesN/AIEA
GO:0018812GO-mf 3-hydroxyacyl-CoA dehydratase activity EnsemblGenomesN/AIEA
GO:0102158GO-mf very-long-chain 3-hydroxyacyl-CoA dehydratase activity EnsemblGenomesN/AIEA
GO:0102343GO-mf 3-hydroxy-arachidoyl-CoA dehydratase activity EnsemblGenomesN/AIEA
GO:0102344GO-mf 3-hydroxy-behenoyl-CoA dehydratase activity EnsemblGenomesN/AIEA
GO:0102345GO-mf 3-hydroxy-lignoceroyl-CoA dehydratase activity EnsemblGenomesN/AIEA
KOG3187 KOG Protein tyrosine phosphatase-like protein PTPLA (contains Pro instead of catalytic Arg) JGI N/AIEA
PTHR11035Panther PTPLA DOMAIN PROTEIN JGI N/AIEA
PTHR11035:SF14Panther JGI N/AIEA
PF04387PFAM Protein tyrosine phosphatase-like protein, PTPLA JGI N/AIEA
PWY-5080SoyCyc9 very long chain fatty acid biosynthesis I Plant Metabolic Network ISS
PWY-7036SoyCyc9 very long chain fatty acid biosynthesis II Plant Metabolic Network ISS
GN7V-53375SoyCyc9-rxn Enzyme name not determined Plant Metabolic Network ISS

Expression Patterns of Glyma.18g146900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.18g146900
ParalogEvidenceComments
Glyma.08g279700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.18g146900 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g29520 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g146900
>Glyma.18g146900.1 sequence-type=CDS polypeptide=Glyma.18g146900.1.p locus=Glyma.18g146900 ID=Glyma.18g146900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTGGTTTCTTCTCTCTTCTAAGGCGCCTCTATCTCTCCCTTTACAATTGGACCGTTTTGTTTGGATGGTGTCAAGTTCTGTATTTTGTTCTCAAGACATTGAACGAATCGGGTCATCAACATGTTTACAGTGCAGCAGAAAAACCTTTGCATTATGCTCAAAGCGCTGCTGTGTTAGAGATTCTTCATGGTTTGGTAGGGCTGGTGAGGTCTCCAGTAACAGCAACATTGCCACAGATAAGTTCAAGGCTGTTTCTGGTTTGGGGCATCTTATGGAGTTTTCCTGAGACTCGGTCCCATGTGCTTGTTACCTCCCTACTAATCAGCTGGTCCATCACAGAGATCATTCGCTATTCTTTCTTTGGCTTTAAAGAGACTTTTGGATTTACTCCATCATGGCTTTTGTGGCTTAGATATAGCAGCTTCTTAGTTTTGTATCCAACAGGCATAAGCAGTGAAGTTGGTTTAATATACATTGCCTTACCATTCATTAAGGCGTCTGGGAAGTATTGCATAAGGATGCCAAACAAATGGAACTCATCATTTGATTACTTCTATGCTGCGATTGTTGCAATGGGAATCTACGTTCCAGGTAGCCCTCACTTGTACACATACATGCTTGCTCAGAGGAAGAAAGCTCTCTCCAAATCGAAGAGAGAGTAA
Predicted protein sequences of Glyma.18g146900
>Glyma.18g146900.1.p sequence-type=predicted peptide transcript=Glyma.18g146900.1 locus=Glyma.18g146900 ID=Glyma.18g146900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAGFFSLLRRLYLSLYNWTVLFGWCQVLYFVLKTLNESGHQHVYSAAEKPLHYAQSAAVLEILHGLVGLVRSPVTATLPQISSRLFLVWGILWSFPETRSHVLVTSLLISWSITEIIRYSFFGFKETFGFTPSWLLWLRYSSFLVLYPTGISSEVGLIYIALPFIKASGKYCIRMPNKWNSSFDYFYAAIVAMGIYVPGSPHLYTYMLAQRKKALSKSKRE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo