SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.18g146300

Feature Type:gene_model
Chromosome:Gm18
Start:24769667
stop:24772625
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g146300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG01100.1AT NADH dehydrogenase family protein JGI N/AIEA
GO:0015979GO-bp photosynthesis EnsemblGenomesN/AIEA
GO:0045333GO-bp cellular respiration EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0005747GO-cc mitochondrial respiratory chain complex I EnsemblGenomesN/AIEA
GO:0005886GO-cc plasma membrane EnsemblGenomesN/AIEA
GO:0009507GO-cc chloroplast EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane JGI N/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
GO:0016651GO-mf oxidoreductase activity, acting on NAD(P)H JGI N/AIEA
GO:0048038GO-mf quinone binding JGI N/AIEA
GO:0051287GO-mf NAD binding JGI N/AIEA
PTHR11432Panther NADH DEHYDROGENASE SUBUNIT 1 JGI N/AIEA
PF00146PFAM NADH dehydrogenase JGI N/AIEA
PF00346PFAM Respiratory-chain NADH dehydrogenase, 49 Kd subunit JGI N/AIEA
PWY-3781SoyCyc9 aerobic respiration I (cytochrome c) Plant Metabolic Network ISS
PWY-4302SoyCyc9 aerobic respiration III (alternative oxidase pathway) Plant Metabolic Network ISS
PWY-5083SoyCyc9 NAD/NADH phosphorylation and dephosphorylation Plant Metabolic Network ISS
GN7V-42149SoyCyc9-rxn NADH:ubiquinone reductase (H+-translocating) Plant Metabolic Network ISS

Expression Patterns of Glyma.18g146300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g146300 not represented in the dataset
Glyma.18g146300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.18g146300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g29605 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g146300
>Glyma.18g146300.1 sequence-type=CDS polypeptide=Glyma.18g146300.1.p locus=Glyma.18g146300 ID=Glyma.18g146300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
AAAAAAGAGTCAGAATGGAATGAGTTTGAGTATCAATTTATTAGTAAAAAACCGTCTCTGACTCTTGAATTGCCAAAGCAAGAACTTTATAAATGGAAAATTCATCTGCCAGGTTTTATTAATTTGCAAATTCTTCCTCGATTAGTTAAAAGAATGAAATTGGCCGATATTATGACAATACTAGGAGATATATGGAATTATATGGTTATTTCCCCTATTTTGATTCTTATATTGGAAATTACAACAAGTGTACTAGCAATTGTATGGTTAGAAAGGGAAATATCCGCAGGGATACAACAACGTATTGGACATGAATGCGCAGGTCCTTTTGGAGTTCTTCAAACTAAAGAGAATCTTATTCCATCTAAAGGAGATATTTTATTTAGTATAGGACCATCTATATCAGTCATATCGATTATAATAAGCTATTCAGTAATTCCTCTTGGCTATAACTTTGTTTTATCTGATCTGAATATTGGTGTTTTTTTATGGATTGTTGTTTTGAGTATTGCTCCCATTGGACTTCTTATGTCAGGATATGGGTCAAATAATAAATATTCCTTTTTGGGTGGTCTATGA
Predicted protein sequences of Glyma.18g146300
>Glyma.18g146300.1.p sequence-type=predicted peptide transcript=Glyma.18g146300.1 locus=Glyma.18g146300 ID=Glyma.18g146300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
KKESEWNEFEYQFISKKPSLTLELPKQELYKWKIHLPGFINLQILPRLVKRMKLADIMTILGDIWNYMVISPILILILEITTSVLAIVWLEREISAGIQQRIGHECAGPFGVLQTKENLIPSKGDILFSIGPSISVISIIISYSVIPLGYNFVLSDLNIGVFLWIVVLSIAPIGLLMSGYGSNNKYSFLGGL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo