SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.18g132700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.18g132700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.18g132700

Feature Type:gene_model
Chromosome:Gm18
Start:18660557
stop:18662985
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g132700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14342.1AT Splicing factor 3B subunit 5/RDS3 complex subunit 10 JGI N/AIEA
GO:0000398GO-bp mRNA splicing, via spliceosome EnsemblGenomesN/AIEA
GO:0005686GO-cc U2 snRNP EnsemblGenomesN/AIEA
GO:0005689GO-cc U12-type spliceosomal complex EnsemblGenomesN/AIEA
GO:0071011GO-cc precatalytic spliceosome EnsemblGenomesN/AIEA
KOG3485 KOG Uncharacterized conserved protein JGI N/AIEA
PTHR20978Panther FAMILY NOT NAMED JGI N/AIEA
PF07189PFAM Splicing factor 3B subunit 10 (SF3b10) JGI N/AIEA

Expression Patterns of Glyma.18g132700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g132700 not represented in the dataset
Glyma.18g132700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.18g132700
ParalogEvidenceComments
Glyma.08g291500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.18g132700 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g17590 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g132700
>Glyma.18g132700.1 sequence-type=CDS polypeptide=Glyma.18g132700.1.p locus=Glyma.18g132700 ID=Glyma.18g132700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCAGGCTAGTGATAGGTTTAACATCAATTCTCAGCTCGAGCATCTCCAAGCCAAATATGTTGGAACTGGCCATGCTGATTTGAACAGATTTGAGTGGGCAGTGAACATTCAACGTGATAGCTATGCATCATATATTGGGCACTACCCTTTACTGGGATTCTTTGCTATTGCTGAAAATGAATCTATTGGAAGAGAACGCTACAGCTTTATGCAGAAAATGCTCCTGCCTTGTGGTTTGCCTCCCGAAAGAGAAGAAGATTAA
Predicted protein sequences of Glyma.18g132700
>Glyma.18g132700.1.p sequence-type=predicted peptide transcript=Glyma.18g132700.1 locus=Glyma.18g132700 ID=Glyma.18g132700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MQASDRFNINSQLEHLQAKYVGTGHADLNRFEWAVNIQRDSYASYIGHYPLLGFFAIAENESIGRERYSFMQKMLLPCGLPPEREED*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo