SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.18g130300

Feature Type:gene_model
Chromosome:Gm18
Start:18041444
stop:18042727
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g130300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G24190.1AT SIN3-like 3 JGI N/AIEA
GO:0000122GO-bp negative regulation of transcription by RNA polymerase II EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0016575GO-bp histone deacetylation EnsemblGenomesN/AIEA
GO:0000118GO-cc histone deacetylase complex EnsemblGenomesN/AIEA
GO:0000785GO-cc chromatin EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus JGI N/AIEA
GO:0004407GO-mf histone deacetylase activity EnsemblGenomesN/AIEA
PTHR12346Panther SIN3B-RELATED JGI N/AIEA
PF02671PFAM Paired amphipathic helix repeat JGI N/AIEA

Expression Patterns of Glyma.18g130300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g130300 not represented in the dataset
Glyma.18g130300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.18g130300
ParalogEvidenceComments
Glyma.08g293100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.18g130300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g17214 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g130300
>Glyma.18g130300.1 sequence-type=CDS polypeptide=Glyma.18g130300.1.p locus=Glyma.18g130300 ID=Glyma.18g130300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCAGATAGTGCCTTAGCATATCTCTCCACAGTCAAGGATGCATTTAAAGATGATAGAGAAAAATTTGATAAATTTTTGGAACTCATGAAAAATTTCACTGCTGATAGATTCAACCTTGTTAGTGGCATAGAAGAAGTGAAGGAGCTGCTTAAAGGGCATAGAGATCTAATTTTTGGATTTAATGTTTTCTTGCCGAAGGGATTTGAAATCAAACTTCCATTGGAGGATGAACAACCTCCACAGAAGAAGCTTGATGTGTTTGTTGAAGCTAAAAAAATTATGCACAAGATTGAGACTCGGTTCCATGGCCAAGATAATGTCTACAAGGCATTTCTAGCCATATTGAAGATGCACAAAGACGGAAACAGGACTCCCCTGCAGCTTACGAGGAGGACCATGTGGATCTTCTAA
Predicted protein sequences of Glyma.18g130300
>Glyma.18g130300.1.p sequence-type=predicted peptide transcript=Glyma.18g130300.1 locus=Glyma.18g130300 ID=Glyma.18g130300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MADSALAYLSTVKDAFKDDREKFDKFLELMKNFTADRFNLVSGIEEVKELLKGHRDLIFGFNVFLPKGFEIKLPLEDEQPPQKKLDVFVEAKKIMHKIETRFHGQDNVYKAFLAILKMHKDGNRTPLQLTRRTMWIF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo