Glyma.18g129100

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.18g129100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.18g129100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.18g129100

Feature Type:	gene_model
Chromosome:	Gm18
Start:	17426745
stop:	17444205
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.18g129100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G59820.1	AT	aminophospholipid ATPase 3	JGI	N/A	IEA
GO:0015914	GO-bp	phospholipid transport	EnsemblGenomes	N/A	IEA
GO:0045332	GO-bp	phospholipid translocation	EnsemblGenomes	N/A	IEA
GO:0048194	GO-bp	Golgi vesicle budding	EnsemblGenomes	N/A	IEA
GO:0000139	GO-cc	Golgi membrane	EnsemblGenomes	N/A	IEA
GO:0005802	GO-cc	trans-Golgi network	EnsemblGenomes	N/A	IEA
GO:0005886	GO-cc	plasma membrane	EnsemblGenomes	N/A	IEA
GO:0016021	GO-cc	integral component of membrane	EnsemblGenomes	N/A	IEA
GO:0000166	GO-mf	nucleotide binding	JGI	N/A	IEA
GO:0000287	GO-mf	magnesium ion binding	EnsemblGenomes	N/A	IEA
GO:0004012	GO-mf	phospholipid-translocating ATPase activity	EnsemblGenomes	N/A	IEA
GO:0005524	GO-mf	ATP binding	EnsemblGenomes	N/A	IEA
GO:0046872	GO-mf	metal ion binding	JGI	N/A	IEA
PTHR24092	Panther	FAMILY NOT NAMED	JGI	N/A	IEA
PTHR24092:SF18	Panther		JGI	N/A	IEA
PF00122	PFAM	E1-E2 ATPase	JGI	N/A	IEA

Expression Patterns of Glyma.18g129100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g129100 not represented in the dataset	Glyma.18g129100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.18g129100 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma18g16950	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.18g129100

Limit To All Plant Sequences

>Glyma.18g129100.1 sequence-type=CDS polypeptide=Glyma.18g129100.1.p locus=Glyma.18g129100 ID=Glyma.18g129100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATCTCAATTTTGTCAACCACACCAATTAGTCCTGTGTCTCCAATAACTAATGTGCTTCCTCTATCTCTGGTGCTTCTTGTCTCTCTTATTAAGGAAGCTTTTGAGGACTGGAAGCGTTTTCAAAATGACATGTCTGTAAACAATAATACAATAGATGTTTTGCAAGATCAAAAGTGGGGGTCTATACCCTGGAAAAAGTTGCAGGTTGGAGACCTTGTTAAGGTTAAGCAGGATGCATTCTTTCCTGCAGATCTGCTTTTCTTGGCTAGCACTAATGCAGATGGTGTCTGCTACATTGAGACTGCTAATTTGGATGGGGAAACAAATTTGAAGATTAGGAAAGCATTGGAAAAGACTTGGGATTACGTGACTCCAGAGAAGGCATCTGAGTTTAAAGGTGAAATTCAATGTGAACAACCAAACAATTCATTGTATACCTTTACTGGAAATCTTATAACTCAAAAGCAAACACTGCCTCTCAGTCCAAATCAAATTTTGTTGCGGGGTTGCAGTCTCAGGAATACAGAGTATATTGTTGGGGTTGTTATATTTACAGGACATGAAACAAAGGTTTGCTTTATAAAATGA

Predicted protein sequences of Glyma.18g129100

Limit To All Plant Sequences

>Glyma.18g129100.1.p sequence-type=predicted peptide transcript=Glyma.18g129100.1 locus=Glyma.18g129100 ID=Glyma.18g129100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MISILSTTPISPVSPITNVLPLSLVLLVSLIKEAFEDWKRFQNDMSVNNNTIDVLQDQKWGSIPWKKLQVGDLVKVKQDAFFPADLLFLASTNADGVCYIETANLDGETNLKIRKALEKTWDYVTPEKASEFKGEIQCEQPNNSLYTFTGNLITQKQTLPLSPNQILLRGCSLRNTEYIVGVVIFTGHETKVCFIK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain