SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.18g121500

Feature Type:gene_model
Chromosome:Gm18
Start:15277770
stop:15277976
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g121500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17230.1AT PHYTOENE SYNTHASE JGI N/AIEA
GO:0009058GO-bp biosynthetic process EnsemblGenomesN/AIEA
GO:0009058GO-bp biosynthetic process JGI N/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0016740GO-mf transferase activity EnsemblGenomesN/AIEA
GO:0016740GO-mf transferase activity JGI N/AIEA
PF00494PFAM Squalene/phytoene synthase JGI N/AIEA
CAROTENOID-PWYSoyCyc9 superpathway of carotenoid biosynthesis in plants Plant Metabolic Network ISS
PWY-6475SoyCyc9 trans-lycopene biosynthesis II (oxygenic phototrophs and green sulfur bacteria) Plant Metabolic Network ISS
GN7V-59804SoyCyc9-rxn phytoene synthase Plant Metabolic Network ISS

Expression Patterns of Glyma.18g121500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g121500 not represented in the dataset
Glyma.18g121500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.18g121500 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g15451 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g121500
>Glyma.18g121500.1 sequence-type=CDS polypeptide=Glyma.18g121500.1.p locus=Glyma.18g121500 ID=Glyma.18g121500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATACAAGGCATGAGAATGGATACAAGGAAAGCCCGATACAACAATTTCCAAGAGTTATATCTTTACTGCTACAATGTGGCGGGAACTGTGGGCTTAATGACTGTTCCAATAATGGGCATTGCCGAGGAGTCTGTCATCCCAGTTCAAAGTGTATATGATGCTGCACTATATCTGGGTGTAGGAAATCAACTCAAACATTCTTAG
Predicted protein sequences of Glyma.18g121500
>Glyma.18g121500.1.p sequence-type=predicted peptide transcript=Glyma.18g121500.1 locus=Glyma.18g121500 ID=Glyma.18g121500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MIQGMRMDTRKARYNNFQELYLYCYNVAGTVGLMTVPIMGIAEESVIPVQSVYDAALYLGVGNQLKHS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo