SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.18g052800

Feature Type:gene_model
Chromosome:Gm18
Start:4573501
stop:4574304
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.18g052800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G48670.1AT AGAMOUS-like 80 JGI N/AIEA
GO:0006351GO-bp transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0045944GO-bp positive regulation of transcription by RNA polymerase II EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0000982GO-mf transcription factor activity, RNA polymerase II proximal promoter sequence-specific DNA binding EnsemblGenomesN/AIEA
GO:0000987GO-mf proximal promoter sequence-specific DNA binding EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding JGI N/AIEA
GO:0046983GO-mf protein dimerization activity EnsemblGenomesN/AIEA
GO:0046983GO-mf protein dimerization activity JGI N/AIEA
KOG0014 KOG MADS box transcription factor JGI N/AIEA
PTHR11945Panther MADS BOX PROTEIN JGI N/AIEA
PTHR11945:SF69Panther JGI N/AIEA
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI N/AIEA

Expression Patterns of Glyma.18g052800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18g052800 not represented in the dataset
Glyma.18g052800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.18g052800
ParalogEvidenceComments
Glyma.11g186400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.18g052800 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g05916 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.18g052800
>Glyma.18g052800.1 sequence-type=CDS polypeptide=Glyma.18g052800.1.p locus=Glyma.18g052800 ID=Glyma.18g052800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGACTAGAAAAAAGGTGAAACTCGCATTCATAGGGAATGATGCTGCAAGGAGGGCAACATACAAGAAAAGGAAGAAGGGGATGCTGAAGAAGGTTGAGGAACTCAGCACCCTCTGTGGCATTGAAGCGTGTGCTATAGTTTATGGCCACAATGATCCTGAGCCAGAGGTTTGGCCATCCCATTGGGGAGTCCAAAGGGTGGTGGAAAAGCTCAGAACTATGCCTGAATTGGAACAACGAAAGAAAATGGTGAACCAGGAGGGTTTCATTGGACAAAAGATCCTGAAGGGTAACGAGAAGGTGATGAAGCTTATGAAGGACAATAGGGAGAAGGAGATAACCATGTTCTTGTTTCAATGCCTTAATGCAGGTAGGATTCAGCCTGATAATAACATGACCACTGCTGATTTGAATGTTCTTTCATCTTTGATTGATCAGAACCTGAAGGACATTAGTAAAAGGTTGGAAACGCTGAGTGTTAACGAGATGACACCAAACCAACCCTTGATGCAAACACCAGCATACCAACCCTTGGTGGAAGCACCATCATGCAACCAATCCCATTTGCAAACACCAGCGTACCAACCCCAGACGCAAACTCCAGCATTGGCAGTACCCAAGAATGAAGAAATGGCACTGCTGAATTATGGCCATGGTTTGGATATGAGTGATAACTCCATGCAAAGGCTGTTGTTTATGGACTTGCTTAATAGTAATGGGGATGAGACGATAATGCCTCCATTTGGTGATGCCAATCTCCAACTCCAAAATGACTTTTGGCCTGACCTAGGCCTATTACCTTGA
Predicted protein sequences of Glyma.18g052800
>Glyma.18g052800.1.p sequence-type=predicted peptide transcript=Glyma.18g052800.1 locus=Glyma.18g052800 ID=Glyma.18g052800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MTRKKVKLAFIGNDAARRATYKKRKKGMLKKVEELSTLCGIEACAIVYGHNDPEPEVWPSHWGVQRVVEKLRTMPELEQRKKMVNQEGFIGQKILKGNEKVMKLMKDNREKEITMFLFQCLNAGRIQPDNNMTTADLNVLSSLIDQNLKDISKRLETLSVNEMTPNQPLMQTPAYQPLVEAPSCNQSHLQTPAYQPQTQTPALAVPKNEEMALLNYGHGLDMSDNSMQRLLFMDLLNSNGDETIMPPFGDANLQLQNDFWPDLGLLP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo