Glyma.18G238600

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.18G238600

Feature Type:	gene_model
Chromosome:	Gm18
Start:	52750924
stop:	52752837
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.18G238600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G41570.1	AT	WRKY DNA-binding protein 24	JGI	N/A	IEA
GO:0006351	GO-bp	transcription, DNA-templated	EnsemblGenomes	N/A	IEA
GO:0006355	GO-bp	regulation of transcription, DNA-templated	EnsemblGenomes	N/A	IEA
GO:0006355	GO-bp	regulation of transcription, DNA-templated	JGI	N/A	IEA
GO:0005634	GO-cc	nucleus	EnsemblGenomes	N/A	IEA
GO:0003677	GO-mf	DNA binding	EnsemblGenomes	N/A	IEA
GO:0003700	GO-mf	DNA binding transcription factor activity	EnsemblGenomes	N/A	IEA
GO:0003700	GO-mf	sequence-specific DNA binding transcription factor activity	JGI	N/A	IEA
GO:0043565	GO-mf	sequence-specific DNA binding	EnsemblGenomes	N/A	IEA
GO:0043565	GO-mf	sequence-specific DNA binding	JGI	N/A	IEA
PF03106	PFAM	WRKY DNA -binding domain	JGI	N/A	IEA

Proteins Associated with Glyma.18G238600

Locus	Gene Symbol	Protein Name
	WRKY64	WRKY transcription factor 64
	WRKY174	WRKY Transcripiton Factor

Expression Patterns of Glyma.18G238600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.18G238600

Paralog	Evidence	Comments
Glyma.09g254400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.18G238600 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g238600	Wm82.a4.v1	ISS	As supplied by JGI
Glyma18g47350	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.18G238600

Limit To All Plant Sequences

>Glyma.18g238600.1 sequence-type=CDS polypeptide=Glyma.18g238600.1.p locus=Glyma.18g238600 ID=Glyma.18g238600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAAAGCCAAGACCCACCAAACCCACCACCCCAAAACAACCCCTTCCTCTTCACGCCAAATTCGATGTTGCAAAGCCCTAATTTGGACCCTCAAGAGCAATTAGGGCTATGTGACATTGACTGGGGTAACCTTTTCTCTGCTCAAAACAGCTTCTTGCTTAATGGGGATGCCAACGATGCAATTGAATGTGCTTCTTCTTCTTCTTTTGTGGCTCAAAATAAGGTAGCTTGTGAAGAGGAAAAGGGAAACAAGGAGAAAAGGAAAGGTGGGAGGATGAAGAAAACAACACGAGTGCCAAGGTTTGCGTTTCAAACGAGAAGTGCAGATGATATTTTGGATGATGGTTATCGCTGGAGGAAATATGGTCAGAAAGCTGTGAAGAATAACACATATCCAAGAAGCTACTACCGCTGCACGCATCACACGTGCAATGTGAAGAAACAAGTGCAAAGGCTATCCAAAGACACAAGCATTGTGGTGACGACTTACGAGGGAATTCACAACCACCCGTGCGAGAAGTTGATGGAAACTCTAACCCCTCTCCTCAAGCAAATACAGTTTCTTGCCAGCTTGTAA

Predicted protein sequences of Glyma.18G238600

Limit To All Plant Sequences

>Glyma.18g238600.1.p sequence-type=predicted peptide transcript=Glyma.18g238600.1 locus=Glyma.18g238600 ID=Glyma.18g238600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MESQDPPNPPPQNNPFLFTPNSMLQSPNLDPQEQLGLCDIDWGNLFSAQNSFLLNGDANDAIECASSSSFVAQNKVACEEEKGNKEKRKGGRMKKTTRVPRFAFQTRSADDILDDGYRWRKYGQKAVKNNTYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHPCEKLMETLTPLLKQIQFLASL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain