Glyma.18G232100

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.18G232100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.18G232100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.18G232100

Feature Type:	gene_model
Chromosome:	Gm18
Start:	52058080
stop:	52061986
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.18G232100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G00520.2	AT	Acyl-CoA thioesterase family protein	JGI	N/A	IEA
GO:0006637	GO-bp	acyl-CoA metabolic process	EnsemblGenomes	N/A	IEA
GO:0047617	GO-mf	acyl-CoA hydrolase activity	EnsemblGenomes	N/A	IEA
PTHR11066	Panther	ACYL-COA THIOESTERASE	JGI	N/A	IEA
PTHR11066:SF8	Panther		JGI	N/A	IEA
PF02551	PFAM	Acyl-CoA thioesterase	JGI	N/A	IEA
PWY-1121	SoyCyc9	suberin monomers biosynthesis	Plant Metabolic Network		ISS
PWY-321	SoyCyc9	cutin biosynthesis	Plant Metabolic Network		ISS
PWY-5148	SoyCyc9	acyl-CoA hydrolysis	Plant Metabolic Network		ISS
PWY-6733	SoyCyc9	sporopollenin precursors biosynthesis	Plant Metabolic Network		ISS
GN7V-64961	SoyCyc9-rxn	palmitoyl-CoA hydrolase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.18G232100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.18G232100 not represented in the dataset	Glyma.18G232100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.18G232100 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g232100	Wm82.a4.v1	ISS	As supplied by JGI

Coding sequences of Glyma.18G232100

Limit To All Plant Sequences

>Glyma.18g232100.1 sequence-type=CDS polypeptide=Glyma.18g232100.1.p locus=Glyma.18g232100 ID=Glyma.18g232100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAGGCACGTGGTGTGAGTCTGGACCACTCCATGTGGTTTCATAGGCATTTAAGAGCTGATGACTGGGTGCTATTTGTGATCTTTAGTCCTACTTCTTCTAATGCCCGGGGCTATGTCACTGGCCAAATGCTCAATCAGAAGGGAGAGCTTCTTGTGTCAGTGGTTCAAGAAGGTCTAATGAGGGAAGTTATTTCTGCAAATTCAGCCATCAAATCTAATCTTTGA

Predicted protein sequences of Glyma.18G232100

Limit To All Plant Sequences

>Glyma.18g232100.1.p sequence-type=predicted peptide transcript=Glyma.18g232100.1 locus=Glyma.18g232100 ID=Glyma.18g232100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKARGVSLDHSMWFHRHLRADDWVLFVIFSPTSSNARGYVTGQMLNQKGELLVSVVQEGLMREVISANSAIKSNL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain