Glyma.17g208000

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.17g208000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.17g208000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.17g208000

Feature Type:	gene_model
Chromosome:	Gm17
Start:	34093823
stop:	34096844
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.17g208000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G25450.1	AT	Cytochrome bd ubiquinol oxidase, 14kDa subunit	JGI	N/A	IEA
AT5G25450.2	AT	Cytochrome bd ubiquinol oxidase, 14kDa subunit	JGI	N/A	IEA
GO:0006122	GO-bp	mitochondrial electron transport, ubiquinol to cytochrome c	EnsemblGenomes	N/A	IEA
GO:0006122	GO-bp	mitochondrial electron transport, ubiquinol to cytochrome c	JGI	N/A	IEA
GO:0009060	GO-bp	aerobic respiration	EnsemblGenomes	N/A	IEA
GO:0034551	GO-bp	mitochondrial respiratory chain complex III assembly	EnsemblGenomes	N/A	IEA
GO:0055114	GO-bp	oxidation-reduction process	EnsemblGenomes	N/A	IEA
GO:1902600	GO-bp	proton transmembrane transport	EnsemblGenomes	N/A	IEA
GO:0005739	GO-cc	mitochondrion	EnsemblGenomes	N/A	IEA
GO:0005743	GO-cc	mitochondrial inner membrane	EnsemblGenomes	N/A	IEA
GO:0005750	GO-cc	mitochondrial respiratory chain complex III	EnsemblGenomes	N/A	IEA
GO:0005750	GO-cc	mitochondrial respiratory chain complex III	JGI	N/A	IEA
GO:0016020	GO-cc	membrane	EnsemblGenomes	N/A	IEA
GO:0016021	GO-cc	integral component of membrane	EnsemblGenomes	N/A	IEA
GO:0070469	GO-cc	respiratory chain	EnsemblGenomes	N/A	IEA
GO:0008121	GO-mf	ubiquinol-cytochrome-c reductase activity	EnsemblGenomes	N/A	IEA
KOG3440	KOG	Ubiquinol cytochrome c reductase, subunit QCR7	JGI	N/A	IEA
PTHR12022	Panther	UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX 14 KD PROTEIN	JGI	N/A	IEA
PF02271	PFAM	Ubiquinol-cytochrome C reductase complex 14kD subunit	JGI	N/A	IEA

Expression Patterns of Glyma.17g208000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.17g208000 not represented in the dataset	Glyma.17g208000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.17g208000

Paralog	Evidence	Comments
Glyma.14g126300	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.17g208000 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma17g31280	Wm82.a1.v1.1	IGC	As supplied by JGI

Transcripts of Glyma.17g208000

Limit To All Plant Sequences

>Glyma.17g208000.2 sequence-type=transcript locus=Glyma.17g208000 ID=Glyma.17g208000.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
GCAAAGAACGGAGTGCGGTGCAAAATAAGAAGCAGCACTTGTCCCTCTTCCTCAGCGATTGTTCGAGAAACTCTAACGAAAGAGCGAGAAAGCGAAGACAGCCATGGCGTCGTTTCTTCAATCGTTTCTGGATCCGAAGAAGAACTGGTTCGCCGCTCAGCACATGAAATCCCTCTCCAAACGCCTCCGCAAATATGGGCTCCGATACGACGATTTGTACGATCCTTACTACGATCTGGATGTGAAGGAGGCGCTGAATCGGCTTCCGAAAGAGGTGGTGGACGCTCGCCACGCGCGTCTTAAACGCGCCATCGATCTTTCCATGAAGCACGAGTACCTCCCTGACAATCTGCAGGTTTTTATTTTTTTCCTTTTTTTCTTATTTTTTTTATGTCTATTTGATTGTTATTGTTGCTGGTATTGAGTTTTAGTTTACGAAGATGAGTGAAAGAAGGAAATACTTATGTGTTGGAATGCAAATATGTGACTGGGTCCAATTAATTAGGTTCTAAGAGATGATGGATGTGTGTGTGAATTTGTTGGTTACAACGAACTTGTTCTTGTTGCTTTTTACTGTGTTGTCAAGTTACAAGAAAGATGGATGAAAAAGAAAACCGTGTGTTAAAATGCTAAGATTCAGATGTGACTGGGTGCAATTAATGAGGGTTTAAGAGATATAACGGATGTTCATGAATATATTGcttgcatctttgtcttggttctggttcatgccctttgtcttggttctttgttctctggttctggtgtcgggttctttgttcatgggtattggtcttggtattttgttcttgcatcttgtacttgttcctgtctctgTTGTTGACTTTTTCGCTACAAGATGTTTGATAAAGAAAATCTTTCATGTTGACATTGTAAGATGTGACTGGGTACAAAGAATTAAGTTTTAAGGAATGATGGGCGTGTATGAATCAATTGATTTACAAtggtcttgtttttagtttgggttcttggttcttTTTTTTTCTTGTTGCTTTTGTTGAGTTATAGTTACAAGCAAGATGAATGAAAAAGAAAATCTTTTTTGTTGAATTGCTATGATGTTATTGGGTCCAGTTTGTTAGGTTTAAGACATGATGGATGTGTATGAATCTATTACTTAATGCTTGCAATAGTCTGAATTTCAGAATATAG

Coding sequences of Glyma.17g208000

Limit To All Plant Sequences

>Glyma.17g208000.1 sequence-type=CDS polypeptide=Glyma.17g208000.1.p locus=Glyma.17g208000 ID=Glyma.17g208000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGTCGTTTCTTCAATCGTTTCTGGATCCGAAGAAGAACTGGTTCGCCGCTCAGCACATGAAATCCCTCTCCAAACGCCTCCGCAAATATGGGCTCCGATACGACGATTTGTACGATCCTTACTACGATCTGGATGTGAAGGAGGCGCTGAATCGGCTTCCGAAAGAGGTGGTGGACGCTCGCCACGCGCGTCTTAAACGCGCCATCGATCTTTCCATGAAGCACGAGTACCTCCCTGACAATCTGCAGTCAATGCAAACACCATTCAGGGGCTACCTTCAGGATATGCTGACTCTTGTGAAGAGAGAGAGAGCAGAACGTGAAGCATTGGGAGGTTTGCCCCTATATCAACGATCCATTCCTTGA

>Glyma.17g208000.2 sequence-type=CDS polypeptide=Glyma.17g208000.2.p locus=Glyma.17g208000 ID=Glyma.17g208000.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGTCGTTTCTTCAATCGTTTCTGGATCCGAAGAAGAACTGGTTCGCCGCTCAGCACATGAAATCCCTCTCCAAACGCCTCCGCAAATATGGGCTCCGATACGACGATTTGTACGATCCTTACTACGATCTGGATGTGAAGGAGGCGCTGAATCGGCTTCCGAAAGAGGTGGTGGACGCTCGCCACGCGCGTCTTAAACGCGCCATCGATCTTTCCATGAAGCACGAGTACCTCCCTGACAATCTGCAGGTTTTTATTTTTTTCCTTTTTTTCTTATTTTTTTTATGTCTATTTGATTGTTATTGTTGCTGGTATTGA

Predicted protein sequences of Glyma.17g208000

Limit To All Plant Sequences

>Glyma.17g208000.1.p sequence-type=predicted peptide transcript=Glyma.17g208000.1 locus=Glyma.17g208000 ID=Glyma.17g208000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASFLQSFLDPKKNWFAAQHMKSLSKRLRKYGLRYDDLYDPYYDLDVKEALNRLPKEVVDARHARLKRAIDLSMKHEYLPDNLQSMQTPFRGYLQDMLTLVKRERAEREALGGLPLYQRSIP*

>Glyma.17g208000.2.p sequence-type=predicted peptide transcript=Glyma.17g208000.2 locus=Glyma.17g208000 ID=Glyma.17g208000.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASFLQSFLDPKKNWFAAQHMKSLSKRLRKYGLRYDDLYDPYYDLDVKEALNRLPKEVVDARHARLKRAIDLSMKHEYLPDNLQVFIFFLFFLFFLCLFDCYCCWY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain