SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.17g206600

Feature Type:gene_model
Chromosome:Gm17
Start:33867799
stop:33870789
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.17g206600
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G32530.1AT ATPase, F0/V0 complex, subunit C protein JGI N/AIEA
GO:0006811GO-bp ion transport EnsemblGenomesN/AIEA
GO:0007035GO-bp vacuolar acidification EnsemblGenomesN/AIEA
GO:0015991GO-bp ATP hydrolysis coupled proton transport EnsemblGenomesN/AIEA
GO:0015991GO-bp ATP hydrolysis coupled proton transport JGI N/AIEA
GO:0000220GO-cc vacuolar proton-transporting V-type ATPase, V0 domain EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0033177GO-cc proton-transporting two-sector ATPase complex, proton-transporting domain EnsemblGenomesN/AIEA
GO:0033177GO-cc proton-transporting two-sector ATPase complex, proton-transporting domain JGI N/AIEA
GO:0033179GO-cc proton-transporting V-type ATPase, V0 domain EnsemblGenomesN/AIEA
GO:0015078GO-mf proton transmembrane transporter activity EnsemblGenomesN/AIEA
GO:0015078GO-mf hydrogen ion transmembrane transporter activity JGI N/AIEA
GO:0046961GO-mf proton-transporting ATPase activity, rotational mechanism EnsemblGenomesN/AIEA
KOG0233 KOG Vacuolar H+-ATPase V0 sector, subunit c'' JGI N/AIEA
PTHR10263Panther V-TYPE PROTON ATPASE PROTEOLIPID SUBUNIT JGI N/AIEA
PTHR10263:SF1Panther JGI N/AIEA
PF00137PFAM ATP synthase subunit C JGI N/AIEA

Expression Patterns of Glyma.17g206600
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.17g206600
ParalogEvidenceComments
Glyma.14g127600 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.17g206600 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma17g31060 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.17g206600
>Glyma.17g206600.1 sequence-type=CDS polypeptide=Glyma.17g206600.1.p locus=Glyma.17g206600 ID=Glyma.17g206600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTGGCACATTCGAGTTCTTGGGGAAGGGCACTCGTCGCGATCTCGCCCTACACCTTCTCCGCCATCGGCATCGCCGTCGCTATCGGCGTCTCCGTCCTCGGCGCCGCCTGGGGGATCTACATCACCGGAAGCAGCTTGATCGGCGCTGCAATCAGGGCTCCTCGAATCACTTCCAAAAATCTCATTAGTGTAATCTTCTGTGAAGCTGTTGCTATATATGGTGTTATTGTGGCTATTATTCTTCAAACCAAATTAGAAAGTGTTCCAGCATCAAATATTTATGCACCAGAGTCTCTTAGGGCTGGATATGCAATCTTTGCATCGGGATTAATTGTGGGCTTCGCAAATCTTGTTTGTGGGTTGTGTGTAGGAATAATTGGAAGCAGCTGTGCATTGTCTGATGCCCAGAACTCCTCTCTCTTTGTGAAAATTCTTGTGATCGAGATCTTTGGTAGTGCGCTGGGGCTATTTGGAGTTATTGTTGGAATAATTATGTCAGCTCAAGCAACATGGCCAACGAAAGTTTAG
Predicted protein sequences of Glyma.17g206600
>Glyma.17g206600.1.p sequence-type=predicted peptide transcript=Glyma.17g206600.1 locus=Glyma.17g206600 ID=Glyma.17g206600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVAHSSSWGRALVAISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIRAPRITSKNLISVIFCEAVAIYGVIVAIILQTKLESVPASNIYAPESLRAGYAIFASGLIVGFANLVCGLCVGIIGSSCALSDAQNSSLFVKILVIEIFGSALGLFGVIVGIIMSAQATWPTKV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo