SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.17g182400

Feature Type:gene_model
Chromosome:Gm17
Start:22439701
stop:22440759
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.17g182400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G47840.1AT hexokinase 3 JGI N/AIEA
GO:0001678GO-bp cellular glucose homeostasis EnsemblGenomesN/AIEA
GO:0005975GO-bp carbohydrate metabolic process EnsemblGenomesN/AIEA
GO:0005975GO-bp carbohydrate metabolic process JGI N/AIEA
GO:0006096GO-bp glycolytic process EnsemblGenomesN/AIEA
GO:0016310GO-bp phosphorylation EnsemblGenomesN/AIEA
GO:0046835GO-bp carbohydrate phosphorylation EnsemblGenomesN/AIEA
GO:0051156GO-bp glucose 6-phosphate metabolic process EnsemblGenomesN/AIEA
GO:0005829GO-cc cytosol EnsemblGenomesN/AIEA
GO:0000166GO-mf nucleotide binding EnsemblGenomesN/AIEA
GO:0004340GO-mf glucokinase activity EnsemblGenomesN/AIEA
GO:0004396GO-mf hexokinase activity EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding JGI N/AIEA
GO:0005536GO-mf glucose binding EnsemblGenomesN/AIEA
GO:0008865GO-mf fructokinase activity EnsemblGenomesN/AIEA
GO:0016301GO-mf kinase activity EnsemblGenomesN/AIEA
GO:0016740GO-mf transferase activity EnsemblGenomesN/AIEA
GO:0016773GO-mf phosphotransferase activity, alcohol group as acceptor EnsemblGenomesN/AIEA
GO:0016773GO-mf phosphotransferase activity, alcohol group as acceptor JGI N/AIEA
GO:0019158GO-mf mannokinase activity EnsemblGenomesN/AIEA
PTHR19443Panther HEXOKINASE JGI N/AIEA
PF03727PFAM Hexokinase JGI N/AIEA
GN7V-43253SoyCyc9-rxn hexokinase Plant Metabolic Network ISS

Expression Patterns of Glyma.17g182400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.17g182400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma17g23070 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.17g182400
>Glyma.17g182400.1 sequence-type=CDS polypeptide=Glyma.17g182400.1.p locus=Glyma.17g182400 ID=Glyma.17g182400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCAACTAACTAGTAACATGAAACAATACCGATATTTGAACAACGACATCATACTCCTTGTGGACCAGATTTTTAAGATGATGCAGAGTTATGATCATATTATTGTCAAACAAGAGCAATGTGTTGAATCCAATTTAAGTGAAAGAAAAACAGTTTTAGAGGTTTGTGAGACAATTGTAAAGCGAGGTGGGAGCTTAGCTGGTGCAGGAATAGTGGGGATTGTACAAAAAATGGAAGAGGATCAGAGAGGTCTCGTCTTTGGGAATGGAAAGAGAAGTGTTGTTGCCATCGATGGGGGCTTATATGAAAATTATCCTCAATACAGGGCTTATTTGCAAGATTCAGTCATAGAGCTGCTAGGAACAGAAAAGTCATTCTGTAATGTGGTGATAGAGCATACTAAAGATGGATCTGGAATAGGAGCTGTTGTATTGGCTACTTCAAACTCCATGTACAACCAAGACTTATAG
Predicted protein sequences of Glyma.17g182400
>Glyma.17g182400.1.p sequence-type=predicted peptide transcript=Glyma.17g182400.1 locus=Glyma.17g182400 ID=Glyma.17g182400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MQLTSNMKQYRYLNNDIILLVDQIFKMMQSYDHIIVKQEQCVESNLSERKTVLEVCETIVKRGGSLAGAGIVGIVQKMEEDQRGLVFGNGKRSVVAIDGGLYENYPQYRAYLQDSVIELLGTEKSFCNVVIEHTKDGSGIGAVVLATSNSMYNQDL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo