SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.17g181200

Feature Type:gene_model
Chromosome:Gm17
Start:21230174
stop:21230815
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.17g181200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G03360.1AT ribosomal RNA processing 4 JGI N/AIEA
GO:0000467GO-bp exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) EnsemblGenomesN/AIEA
GO:0034427GO-bp nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5' EnsemblGenomesN/AIEA
GO:0034475GO-bp U4 snRNA 3'-end processing EnsemblGenomesN/AIEA
GO:0043928GO-bp exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay EnsemblGenomesN/AIEA
GO:0071034GO-bp CUT catabolic process EnsemblGenomesN/AIEA
GO:0071035GO-bp nuclear polyadenylation-dependent rRNA catabolic process EnsemblGenomesN/AIEA
GO:0071038GO-bp nuclear polyadenylation-dependent tRNA catabolic process EnsemblGenomesN/AIEA
GO:0071049GO-bp nuclear retention of pre-mRNA with aberrant 3'-ends at the site of transcription EnsemblGenomesN/AIEA
GO:0071051GO-bp polyadenylation-dependent snoRNA 3'-end processing EnsemblGenomesN/AIEA
GO:0000176GO-cc nuclear exosome (RNase complex) EnsemblGenomesN/AIEA
GO:0000177GO-cc cytoplasmic exosome (RNase complex) EnsemblGenomesN/AIEA
GO:0000178GO-cc exosome (RNase complex) EnsemblGenomesN/AIEA
GO:0003723GO-mf RNA binding EnsemblGenomesN/AIEA
PTHR21321Panther PNAS-3 RELATED JGI N/AIEA
PTHR21321:SF2Panther JGI N/AIEA

Expression Patterns of Glyma.17g181200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.17g181200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma17g22080 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.17g181200
>Glyma.17g181200.1 sequence-type=CDS polypeptide=Glyma.17g181200.1.p locus=Glyma.17g181200 ID=Glyma.17g181200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTCATACGGCGTCCTCAAGGGTCACGAAACTGCCGACCTCAACGGCGAAGTCGTTGCCACCCTCTGCGGCGTCGTAGAGCACATCAACAAACTTGTCTACGTTCGCGCGTTACGCTCCAAATATAAACCTGAGGTTGGTGACATTGTTATAGGGCGTGTTGTTGAGGTTGCTCAGAAGTGTTGGCGATTGGAGATAAATTACAACCAGGATGCAGTTTTGCTGCTTTCTTCTATGAACATGCGTGATGGTGTTTAG
Predicted protein sequences of Glyma.17g181200
>Glyma.17g181200.1.p sequence-type=predicted peptide transcript=Glyma.17g181200.1 locus=Glyma.17g181200 ID=Glyma.17g181200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSYGVLKGHETADLNGEVVATLCGVVEHINKLVYVRALRSKYKPEVGDIVIGRVVEVAQKCWRLEINYNQDAVLLLSSMNMRDGV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo