SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.17g176600

Feature Type:gene_model
Chromosome:Gm17
Start:18797340
stop:18797756
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.17g176600
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G10400.1AT Histone superfamily protein JGI N/AIEA
GO:0006334GO-bp nucleosome assembly EnsemblGenomesN/AIEA
GO:0000786GO-cc nucleosome EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0005694GO-cc chromosome EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding JGI N/AIEA
GO:0031492GO-mf nucleosomal DNA binding EnsemblGenomesN/AIEA
GO:0046982GO-mf protein heterodimerization activity EnsemblGenomesN/AIEA
KOG1745 KOG Histones H3 and H4 JGI N/AIEA
PTHR11426Panther HISTONE H3 JGI N/AIEA
PF00125PFAM Core histone H2A/H2B/H3/H4 JGI N/AIEA

Expression Patterns of Glyma.17g176600
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.17g176600 not represented in the dataset
Glyma.17g176600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.17g176600 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma17g20333 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.17g176600
>Glyma.17g176600.1 sequence-type=CDS polypeptide=Glyma.17g176600.1.p locus=Glyma.17g176600 ID=Glyma.17g176600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTCGTACGAAGCAAACCGCAAGGAAGTCCACCAGAGGAAAAGCTTCGAGAAAGCAACTTGCCACGAAAGCAGCACACAAGTCCGCTCCGGCGACCGGCGGCGTGAAGAAGCCGCACCGTTTCAGGCCAAGTACGGTGGCGCTAAGGGAGATCCGAAAGTACCAAAAGAACACCGAGCTTCTCATAAGGAAGCTTCCTTTCCAAAGACTCGTAAGGGAAATCGCTCAGGACTTCAAGACCAATCTCTACTTCCACAGCAGCGCCGTCTCCACTCTCCAAGAAGCCGTAGAGGCCTACCTCGTTGTGCTCTTCGAGGACACCAACCTCTGCACCATTCACCCAAAAGAGTTACCATTATGCCAAAGGACTGAGGCCTACCTTGTTGGGCTCTTGTTTATTTTCATTGAATATTGA
Predicted protein sequences of Glyma.17g176600
>Glyma.17g176600.1.p sequence-type=predicted peptide transcript=Glyma.17g176600.1 locus=Glyma.17g176600 ID=Glyma.17g176600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MARTKQTARKSTRGKASRKQLATKAAHKSAPATGGVKKPHRFRPSTVALREIRKYQKNTELLIRKLPFQRLVREIAQDFKTNLYFHSSAVSTLQEAVEAYLVVLFEDTNLCTIHPKELPLCQRTEAYLVGLLFIFIEY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo