Report for Sequence Feature Glyma.17g103200
Feature Type: gene_model
Chromosome: Gm17
Start: 8096158
stop: 8099747
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.17g103200
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G03350.1 AT
Protein of unknown function, DUF538
JGI N/A IEA
PF04398 PFAM
Protein of unknown function, DUF538
JGI N/A IEA
Expression Patterns of Glyma.17g103200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.17g103200
Paralog Evidence Comments
Glyma.05g024100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.17g103200 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma17g11140 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.17g103200
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.17g103200.1 sequence-type=CDS polypeptide=Glyma.17g103200.1.p locus=Glyma.17g103200 ID=Glyma.17g103200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGATAAAGCTCTCACTAAACTGGGTAGCACTTGGATCTCCAAGAAAGCCAAGGCAGAGATTTCCCACATAACCGACGACCTATCATCTCTCTCAAATACTGTCGAAGAGAAGGCAAAGCTTTTCATCAACAAGCTCAAAGGTAAAACCCAGAAAGCCTTGCCAGATCTCCTTCGAGAGTACAGCATTCCTCCGGGTCTGTTCCCCCGCAACATAACATGCTACGAATTTGATGCATCAAAGGGAAAGTTGATCGTGTACTTATCCTCACCCTGTGAGGTGTGCTTCAAGGACTCATCCATTGTGAGGTATGCAAATCGTGTCAAAGGAACATTATCAAAGGGGAAGCTCAGTGTTACAGATGGAATGAAGACCAAGGTTCTTGTGTGGGTCAAGGTGACTAGTGTTGTTGTTGAGAGTTACAAGTCTGACAAAGTATGGTTCACTACCACCGGAGTTAAGAAATCAAGGCCCAAAGATGCATATGAAATGCCTCGTGATGCTATTAAGGTAGAAGAATTTTGA
Predicted protein sequences of Glyma.17g103200
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.17g103200.1.p sequence-type=predicted peptide transcript=Glyma.17g103200.1 locus=Glyma.17g103200 ID=Glyma.17g103200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MDKALTKLGSTWISKKAKAEISHITDDLSSLSNTVEEKAKLFINKLKGKTQKALPDLLREYSIPPGLFPRNITCYEFDASKGKLIVYLSSPCEVCFKDSSIVRYANRVKGTLSKGKLSVTDGMKTKVLVWVKVTSVVVESYKSDKVWFTTTGVKKSRPKDAYEMPRDAIKVEEF*