SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.17g090500

Feature Type:gene_model
Chromosome:Gm17
Start:7052506
stop:7053858
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.17g090500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G20970.1AT basic helix-loop-helix (bHLH) DNA-binding superfamily protein JGI N/AIEA
GO:0006357GO-bp regulation of transcription by RNA polymerase II EnsemblGenomesN/AIEA
GO:0090575GO-cc RNA polymerase II transcription factor complex EnsemblGenomesN/AIEA
GO:0000977GO-mf RNA polymerase II regulatory region sequence-specific DNA binding EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding EnsemblGenomesN/AIEA
GO:0003700GO-mf DNA binding transcription factor activity EnsemblGenomesN/AIEA
GO:0046983GO-mf protein dimerization activity EnsemblGenomesN/AIEA
GO:0046983GO-mf protein dimerization activity JGI N/AIEA
PF00010PFAM Helix-loop-helix DNA-binding domain JGI N/AIEA

Expression Patterns of Glyma.17g090500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.17g090500
ParalogEvidenceComments
Glyma.05g036800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.17g090500 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma17g09810 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.17g090500
>Glyma.17g090500.1 sequence-type=CDS polypeptide=Glyma.17g090500.1.p locus=Glyma.17g090500 ID=Glyma.17g090500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAAAACACAAACACTAATACTAGTGGTTCACCAAAACTTGATCGCAAAACTATTGAAAGGAACCGCAGGATTCACATGAAATCTCTCTGCTTCAAGCTTGTTTCCACTATTCCTTCCAATTACCTCAAAACCTCCAAGGACATGCTTTCCCAGCAGGATCAGCTTCATCTAGCAGCCACGTACATAAAGCATCTGAGAGAAAGAATAGAGAAATTGAAGGGGGAGAAGGAGAAAGCCATGAACATGATGATGATGTCAAACCAAAGCAATAATAGGATTTTCAATACTGGCTCTGAGTTGCCTCTACTTGAAATAAAGGACTTGGGTTCGGGCATTGAAGTGATGTTGATAAGTGGGTTGAATAAGAACTTCATGCTCTATGAAGTAATTAGTGTCCTTGAGGAAGAGGGTGCTGAAGTTGTCGCTGCCAACTTCTCCACCGTTGCTGATAAGATCTTTTTACACGTTTCATGCTCAGGTTAA
Predicted protein sequences of Glyma.17g090500
>Glyma.17g090500.1.p sequence-type=predicted peptide transcript=Glyma.17g090500.1 locus=Glyma.17g090500 ID=Glyma.17g090500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKNTNTNTSGSPKLDRKTIERNRRIHMKSLCFKLVSTIPSNYLKTSKDMLSQQDQLHLAATYIKHLRERIEKLKGEKEKAMNMMMMSNQSNNRIFNTGSELPLLEIKDLGSGIEVMLISGLNKNFMLYEVISVLEEEGAEVVAANFSTVADKIFLHVSCSG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo