SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.17g074400

Feature Type:gene_model
Chromosome:Gm17
Start:5825716
stop:5828741
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.17g074400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G30950.1AT fatty acid desaturase 6 JGI N/AIEA
GO:0006629GO-bp lipid metabolic process EnsemblGenomesN/AIEA
GO:0006629GO-bp lipid metabolic process JGI N/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
PTHR19353Panther FATTY ACID DESATURASE 2 JGI N/AIEA
PTHR19353:SF7Panther JGI N/AIEA
PF00487PFAM Fatty acid desaturase JGI N/AIEA
PWY-5995SoyCyc9 linoleate biosynthesis I (plants) Plant Metabolic Network ISS
PWY-762SoyCyc9 phospholipid desaturation Plant Metabolic Network ISS
PWY-782SoyCyc9 glycolipid desaturation Plant Metabolic Network ISS
GN7V-44475SoyCyc9-rxn Enzyme name not determined Plant Metabolic Network ISS

Proteins Associated with Glyma.17g074400
LocusGene SymbolProtein Name
FAD6.2 delta-12 desaturase, chloroplastic

Expression Patterns of Glyma.17g074400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.17g074400
ParalogEvidenceComments
Glyma.02g203300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.17g074400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma17g08220 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.17g074400
>Glyma.17g074400.1 sequence-type=CDS polypeptide=Glyma.17g074400.1.p locus=Glyma.17g074400 ID=Glyma.17g074400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTGCAGAACCCAGTTCTTCCGAGACACATTGCTGCCCAGTACTCCCCGGGAATATTTAGCCTAAACAGTAATGGGCTTATCCAGAAAGGGTTCAGGCGTCAAAGGAATTTCGTTACTAGGAATAAGGTTACTGTCATACGTGCCGTGGCAATTCCAGTACAACCAGCTCCGGTGGAAAGTGCGGAGTATAGAAAACAACTAGCTGAAGACTACGGTTTCAGGCAAATTGGAGAGTCGCTTCCTGATGATGTTACTTTAAAGGATGTCATCAATTCCCTTCCTAAGGAGGTCTTTGAGATTGATGATGTGAAAGCATGGAAATCTGTTTTGATATCTGTCACTTCTTGTGCACTGGGGATCTTCTTGATTTCCAAAGCTCCCTGGTATCTTCTTCCTCTGGTTTGGGCATGGACAGGGACTGCAATAACTGGGTTCTTTGTTATAGGACATGATTGTGCTCACAAATCATTTTCGTCTAACAAATTGGTAGAGGACATTGTTGGAACTTTGGCCTTTATGCCCCTGATTTATCCATATGAGCCTTGGCGATTTAAGCATGACAGGCATCATGCAAAAACAAACATGCTAAAGACAACATGCATAATGCATTGTACGAGACATAATGGTAACATCCATGTTATGGATAAAATCCTGTTATTCCTGTACCATGGTTTATTTACACGAAGCAAACAAACGTATACATGA
Predicted protein sequences of Glyma.17g074400
>Glyma.17g074400.1.p sequence-type=predicted peptide transcript=Glyma.17g074400.1 locus=Glyma.17g074400 ID=Glyma.17g074400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVQNPVLPRHIAAQYSPGIFSLNSNGLIQKGFRRQRNFVTRNKVTVIRAVAIPVQPAPVESAEYRKQLAEDYGFRQIGESLPDDVTLKDVINSLPKEVFEIDDVKAWKSVLISVTSCALGIFLISKAPWYLLPLVWAWTGTAITGFFVIGHDCAHKSFSSNKLVEDIVGTLAFMPLIYPYEPWRFKHDRHHAKTNMLKTTCIMHCTRHNGNIHVMDKILLFLYHGLFTRSKQTYT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo