SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.17g054800

Feature Type:gene_model
Chromosome:Gm17
Start:4168633
stop:4170757
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.17g054800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G20300.1AT Protein kinase superfamily protein JGI N/AIEA
GO:0006468GO-bp protein phosphorylation EnsemblGenomesN/AIEA
GO:0006468GO-bp protein phosphorylation JGI N/AIEA
GO:0007166GO-bp cell surface receptor signaling pathway EnsemblGenomesN/AIEA
GO:0007178GO-bp transmembrane receptor protein serine/threonine kinase signaling pathway EnsemblGenomesN/AIEA
GO:0018108GO-bp peptidyl-tyrosine phosphorylation EnsemblGenomesN/AIEA
GO:0005886GO-cc plasma membrane EnsemblGenomesN/AIEA
GO:0004672GO-mf protein kinase activity EnsemblGenomesN/AIEA
GO:0004672GO-mf protein kinase activity JGI N/AIEA
GO:0004675GO-mf transmembrane receptor protein serine/threonine kinase activity EnsemblGenomesN/AIEA
GO:0004713GO-mf protein tyrosine kinase activity EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding JGI N/AIEA
PTHR24420Panther LEUCINE-RICH REPEAT RECEPTOR-LIKE PROTEIN KINASE JGI N/AIEA
PTHR24420:SF801Panther JGI N/AIEA
PF00069PFAM Protein kinase domain JGI N/AIEA
PF07714PFAM Protein tyrosine kinase JGI N/AIEA

Expression Patterns of Glyma.17g054800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.17g054800 not represented in the dataset
Glyma.17g054800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.17g054800 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma17g06251 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.17g054800
>Glyma.17g054800.1 sequence-type=CDS polypeptide=Glyma.17g054800.1.p locus=Glyma.17g054800 ID=Glyma.17g054800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAATTTCATAGGTACTGCTGGATCATTTAGAGGCGCGGGAACTGGTTCTGTTTCCACACTTAACGGTACGAAAGACATCGAGAAAGCAACTGATAATTTCCATGCTTCAAGAATACCTGGAGAGGGGGTTTTTGGCCTTGTTTACAGTGGTATCCTTGAAGATGGGATGAAAGTGGCATTCAAGGTTCTAAAAAGGGAGGACCCTCATGGTGATCATGAATTCTTAGCTGAAGTTGAGATGCTTAGTCGTCTTCACCATAGAAATTTGGTCAAGTTAATTGGGGTTGACAGGGAAATCAGCCCCCTTGATTGGGGTGCCCGGATGAAAATAGCTCTTGGAGCAGCTCCTGGTCTTGCTTATCTGCATGAAGATTCAAGTCCTCGTGTTATACATAGGGACTTCAAGTCTAGCAACATATTGAACAACCGAACAAGTGATGAATTTGAATCCATGACAATATCTGCACTTGGTCAAAAGTCAAAACCTATTATTCAGCAAGATTTGGCAGAGTCTGGATCATATAGAAGAAACTCTTATTCAGGTTCGCTGAGAACCGGAAGAAGCCGGCGGTTGTGGCAGATAATTAAGATTCTTTCCTAG
Predicted protein sequences of Glyma.17g054800
>Glyma.17g054800.1.p sequence-type=predicted peptide transcript=Glyma.17g054800.1 locus=Glyma.17g054800 ID=Glyma.17g054800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MNFIGTAGSFRGAGTGSVSTLNGTKDIEKATDNFHASRIPGEGVFGLVYSGILEDGMKVAFKVLKREDPHGDHEFLAEVEMLSRLHHRNLVKLIGVDREISPLDWGARMKIALGAAPGLAYLHEDSSPRVIHRDFKSSNILNNRTSDEFESMTISALGQKSKPIIQQDLAESGSYRRNSYSGSLRTGRSRRLWQIIKILS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo