SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.17g021200

Feature Type:gene_model
Chromosome:Gm17
Start:1560104
stop:1562910
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.17g021200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G18900.1AT 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein JGI N/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0005506GO-mf iron ion binding EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity JGI N/AIEA
GO:0016705GO-mf oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen EnsemblGenomesN/AIEA
GO:0016706GO-mf oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors JGI N/AIEA
GO:0031418GO-mf L-ascorbic acid binding EnsemblGenomesN/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
KOG1591 KOG Prolyl 4-hydroxylase alpha subunit JGI N/AIEA
PTHR10869Panther PROLYL 4-HYDROXYLASE ALPHA SUBUNIT JGI N/AIEA
PF01549PFAM ShK domain-like JGI N/AIEA
PF03171PFAM 2OG-Fe(II) oxygenase superfamily JGI N/AIEA
GN7V-43931SoyCyc9-rxn procollagen-proline dioxygenase Plant Metabolic Network ISS

Proteins Associated with Glyma.17g021200
LocusGene SymbolProtein Name
OXR17 Oxidoreductase 17

Expression Patterns of Glyma.17g021200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.17g021200
ParalogEvidenceComments
Glyma.07g253200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.17g021200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma17g02430 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.17g021200
>Glyma.17g021200.1 sequence-type=CDS polypeptide=Glyma.17g021200.1.p locus=Glyma.17g021200 ID=Glyma.17g021200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAGTAGTAGGGTTTGGTTTCTACTATTCCTTCTGCTGATCTCGAAATGCCATCAAGTGTGGGGCTCCTACGCGGGTTCCGCTAGCTCCATCGTCAACCCTTCCAAGGTCAAACAGATTTCCTGGAAGCCAAGAGCTTTCGTTTATGAAGGTTTCCTCACGGATTTGGAATGCGACCACTTGATCTCTTTAGCCAAATCGGAGCTTAAGAGATCTGCCGTAGCGGATAATCTCTCTGGAGAGAGCCAGTTAAGTGATGTTCGAACAAGCTCTGGAATGTTCATTTCCAAGAACAAGGATCCTATTATTTCTGGTATTGAGGACAAGATTTCGTCATGGACCTTTCTTCCAAAAGAAAATGGGGAAGATATACAAGTACTGAGGTATGAGCATGGCCAGAAATATGACCCGCATTATGATTACTTCACTGATAAAGTTAACATTGCTCGGGGTGGACATCGCATTGCGACTGTTCTCATGTATCTCACTAATGTAACCAAAGGTGGTGAAACTGTGTTCCCTTCTGCCGAGGAACCTCCACGTCGCAGAGGTACTGAAACAAGTAGTGATCTTTCTGAATGTGCCAAGAAAGGAATAGCAGTGAAACCGCATAGAGGGGACGCACTTCTTTTCTTCAGTCTTCACACAAATGCTACCCCAGACACTAGCAGTCTCCATGCTGGATGCCCTGTAATCGAAGGTGAGAAATGGTCCGCAACGAAGTGGATTCATGTAGACTCGTTTGATAAGACTGTGGGAGCTGGAGGTGATTGTTCTGATCATCATGTAAGCTGTGAGAGATGGGCTTCACTTGGAGAATGCACTAAAAATCCTGAGTATATGATTGGATCTTCAGACGTTCCTGGCTATTGTAGGAAAAGCTGCAAGTCGTGTTAG
Predicted protein sequences of Glyma.17g021200
>Glyma.17g021200.1.p sequence-type=predicted peptide transcript=Glyma.17g021200.1 locus=Glyma.17g021200 ID=Glyma.17g021200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSSRVWFLLFLLLISKCHQVWGSYAGSASSIVNPSKVKQISWKPRAFVYEGFLTDLECDHLISLAKSELKRSAVADNLSGESQLSDVRTSSGMFISKNKDPIISGIEDKISSWTFLPKENGEDIQVLRYEHGQKYDPHYDYFTDKVNIARGGHRIATVLMYLTNVTKGGETVFPSAEEPPRRRGTETSSDLSECAKKGIAVKPHRGDALLFFSLHTNATPDTSSLHAGCPVIEGEKWSATKWIHVDSFDKTVGAGGDCSDHHVSCERWASLGECTKNPEYMIGSSDVPGYCRKSCKSC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo