|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G28060.1 | AT | Ribosomal protein S24e family protein | JGI | N/A | IEA |
| GO:0000462 | GO-bp | maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) | EnsemblGenomes | N/A | IEA |
| GO:0006412 | GO-bp | translation | EnsemblGenomes | N/A | IEA |
| GO:0006412 | GO-bp | translation | JGI | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | EnsemblGenomes | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | JGI | N/A | IEA |
| GO:0005840 | GO-cc | ribosome | EnsemblGenomes | N/A | IEA |
| GO:0005840 | GO-cc | ribosome | JGI | N/A | IEA |
| GO:0022627 | GO-cc | cytosolic small ribosomal subunit | EnsemblGenomes | N/A | IEA |
| GO:0003735 | GO-mf | structural constituent of ribosome | EnsemblGenomes | N/A | IEA |
| GO:0003735 | GO-mf | structural constituent of ribosome | JGI | N/A | IEA |
| PTHR10496 | Panther | 40S RIBOSOMAL PROTEIN S24 | JGI | N/A | IEA |
| PF01282 | PFAM | Ribosomal protein S24e | JGI | N/A | IEA |
|
Glyma.17G147100 not represented in the dataset |
Glyma.17G147100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.17g147100 | Wm82.a4.v1 | ISS | As supplied by JGI |
>Glyma.17g147100.1 sequence-type=CDS polypeptide=Glyma.17g147100.1.p locus=Glyma.17g147100 ID=Glyma.17g147100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCAGACAAGGCAGTCACCATCCGAACCAGAATGTTTATGACAACCAGGCTTCTCTCCGGAAAGCAGTTCGTCATTGATGTCCTTCATCCAGGGAGCGCTAATGATTCCAAGGCTGAACTGAAGGAGAAGCTAAGGAGAATGTATGACGAGAAAGACACCAACCCTGTATTTGCCTTCAAGTTCCGAACTCATTTTGGTGGTGGGAAATCCACTGGGTTTGGTGTTTAA
>Glyma.17g147100.1.p sequence-type=predicted peptide transcript=Glyma.17g147100.1 locus=Glyma.17g147100 ID=Glyma.17g147100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MADKAVTIRTRMFMTTRLLSGKQFVIDVLHPGSANDSKAELKEKLRRMYDEKDTNPVFAFKFRTHFGGGKSTGFGV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||