|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G28740.1 | AT | histone H4 | JGI | N/A | IEA |
| GO:0006334 | GO-bp | nucleosome assembly | EnsemblGenomes | N/A | IEA |
| GO:0006352 | GO-bp | DNA-templated transcription, initiation | JGI | N/A | IEA |
| GO:0009414 | GO-bp | response to water deprivation | EnsemblGenomes | N/A | IEA |
| GO:0000786 | GO-cc | nucleosome | EnsemblGenomes | N/A | IEA |
| GO:0000788 | GO-cc | nuclear nucleosome | EnsemblGenomes | N/A | IEA |
| GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
| GO:0005634 | GO-cc | nucleus | JGI | N/A | IEA |
| GO:0005694 | GO-cc | chromosome | EnsemblGenomes | N/A | IEA |
| GO:0005730 | GO-cc | nucleolus | EnsemblGenomes | N/A | IEA |
| GO:0005774 | GO-cc | vacuolar membrane | EnsemblGenomes | N/A | IEA |
| GO:0005829 | GO-cc | cytosol | EnsemblGenomes | N/A | IEA |
| GO:0005886 | GO-cc | plasma membrane | EnsemblGenomes | N/A | IEA |
| GO:0009506 | GO-cc | plasmodesma | EnsemblGenomes | N/A | IEA |
| GO:0009507 | GO-cc | chloroplast | EnsemblGenomes | N/A | IEA |
| GO:0009579 | GO-cc | thylakoid | EnsemblGenomes | N/A | IEA |
| GO:0003677 | GO-mf | DNA binding | EnsemblGenomes | N/A | IEA |
| GO:0003677 | GO-mf | DNA binding | JGI | N/A | IEA |
| GO:0042393 | GO-mf | histone binding | EnsemblGenomes | N/A | IEA |
| GO:0046982 | GO-mf | protein heterodimerization activity | EnsemblGenomes | N/A | IEA |
| KOG3467 | KOG | Histone H4 | JGI | N/A | IEA |
| PTHR10484 | Panther | HISTONE H4 | JGI | N/A | IEA |
| PF00125 | PFAM | Core histone H2A/H2B/H3/H4 | JGI | N/A | IEA |
|
Glyma.17G063200 not represented in the dataset |
Glyma.17G063200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.20g083800 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.17g063200 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma17g07070 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.17g063200.1 sequence-type=CDS polypeptide=Glyma.17g063200.1.p locus=Glyma.17g063200 ID=Glyma.17g063200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTCTGGAAGAGGAAAGGGAGGCAAGGGTCTCGGAAAGGGAGGAGCCAAACGACACCGTAAGGTTCTGAGGGATAACATTCAGGGAATCACCAAGCCCGCGATTCGCCGTCTGGCCAGACGTGGTGGCGTCAAGCGTATCAGTGGTCTTATCTATGAAGAAACTCGCGGTGTTCTCAAGATCTTTCTAGAGAACGTCATTCGTGACGCTGTCACCTACACTGAACACGCTCGCCGCAAGACCGTCACTGCCATGGACGTTGTTTACGCCCTCAAGAGGCAGGGGAGGACCCTTTACGGATTTGGCGGTTAG
>Glyma.17g063200.1.p sequence-type=predicted peptide transcript=Glyma.17g063200.1 locus=Glyma.17g063200 ID=Glyma.17g063200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||