SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.16g180300

Feature Type:gene_model
Chromosome:Gm16
Start:34086273
stop:34087501
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G23950.1AT Calcium-dependent lipid-binding (CaLB domain) family protein JGI N/AIEA
GO:0005515GO-mf protein binding JGI N/AIEA
PF00168PFAM C2 domain JGI N/AIEA

LocusGene SymbolProtein Name
C2-150 C2 domain containing protein gene 150

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.09g134500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma16g29930 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.16g180300.1 sequence-type=CDS polypeptide=Glyma.16g180300.1.p locus=Glyma.16g180300 ID=Glyma.16g180300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTTCTCGCTACGAACTCGAGCTGAAGCTCGCATCAGCGCGCGGCCTCAAGAACGTGAACTGGCGCCACGGCCCTAACCGCCCATACGCCGTCGTTTGGGTGGACCCCAGGAACAAGTGTTCCACGCGTGTAGACGAAGACGGCGATACCGAAGCCACCTGGGACCAAACCCTACTTATTCCTCTCCCCCCGGAGCCCCTCGAGAATCTCACCCTCTACGTGGACGCGGTCCACGCCGGCTCCGAGGAAGATACCGAGCCGCTTATTGGAGCGGCTCAGCTCAAGCTCGTCGATATTCTCGACGAGGTCGGAGTCGGCGAGAGCGTGAACCGCACGCTCTCGCTGAAGCGTCCCTCCGGGAGACCCCAAGGGAAGGTCGACGTAAATGTTGTTATAAGAGAGTTTGGCTATCGTGCGCATGGCGGGTACTACGCACCTTCTTATGGCGTGAGGGAGAGGGATTATTCTGCGCCGGTTCAGGATGGTTATAATTCTGCGCCTCGAACGGCGTCGTATGGACAGGGATATGCGGGGCCTCAAACGGCGTCGTATGGGCAGGGGAGTGGTTATGGTTACGGTTATGATCAAGAAGAGAAGAAGAGTAATAAGTTTGGGGGCATGGGGACGGGATTGGCTGTGGGCGCGGTTGCTGGGGTTCTAGGAGGAATCGCGCTTGTGGAAGGTGCTGAGTATGTTGAGGACAAGATTACTGATGACGTGGCAGAGAGGGTTGAGGATGATCTTGGTTATGATGAAGATGATTTCTAG

>Glyma.16g180300.1.p sequence-type=predicted peptide transcript=Glyma.16g180300.1 locus=Glyma.16g180300 ID=Glyma.16g180300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASRYELELKLASARGLKNVNWRHGPNRPYAVVWVDPRNKCSTRVDEDGDTEATWDQTLLIPLPPEPLENLTLYVDAVHAGSEEDTEPLIGAAQLKLVDILDEVGVGESVNRTLSLKRPSGRPQGKVDVNVVIREFGYRAHGGYYAPSYGVRERDYSAPVQDGYNSAPRTASYGQGYAGPQTASYGQGSGYGYGYDQEEKKSNKFGGMGTGLAVGAVAGVLGGIALVEGAEYVEDKITDDVAERVEDDLGYDEDDF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo