SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.16g162600

Feature Type:gene_model
Chromosome:Gm16
Start:32154717
stop:32155227
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.16g162600
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29930.1AT chlorophyll A/B binding protein 1 JGI N/AIEA
GO:0009765GO-bp photosynthesis, light harvesting EnsemblGenomesN/AIEA
GO:0015979GO-bp photosynthesis EnsemblGenomesN/AIEA
GO:0018298GO-bp protein-chromophore linkage EnsemblGenomesN/AIEA
GO:0009507GO-cc chloroplast EnsemblGenomesN/AIEA
GO:0009522GO-cc photosystem I EnsemblGenomesN/AIEA
GO:0009523GO-cc photosystem II EnsemblGenomesN/AIEA
GO:0009535GO-cc chloroplast thylakoid membrane EnsemblGenomesN/AIEA
GO:0009536GO-cc plastid EnsemblGenomesN/AIEA
GO:0009579GO-cc thylakoid EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0016168GO-mf chlorophyll binding EnsemblGenomesN/AIEA
PTHR21649Panther CHLOROPHYLL A/B BINDING PROTEIN JGI N/AIEA
PF00504PFAM Chlorophyll A-B binding protein JGI N/AIEA

Expression Patterns of Glyma.16g162600
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.16g162600 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma09g07310 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.16g162600
>Glyma.16g162600.1 sequence-type=CDS polypeptide=Glyma.16g162600.1.p locus=Glyma.16g162600 ID=Glyma.16g162600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
GATGTAGATTACTTGGGCAACCCAAGCCTGATCCATGCACAAAGCATCCTTGCCATCTGGGCCACTCAAGTTATCTTGATGGGTGCTGTTGAGGGTTACCGTATTGCTGGTGGGCCTCTCGGTGAAGTGACTGACCCAATCTACCCAGGTGGCAGCTTTGACCCATTGGGCCTTGCTGATGACCCAGAGGCTTTTGCTGAGTTGAAGGTGAAAGAGCTCAAGAATGGTAGGTTGGCCATGTTCTCCATGTTTGGTTTCTTTGTTCAGGCCATTGTGACAGGAAAGGGACCTTTGGAAAATCTTGCTGATCACCTAGCTGACCCAGTAAACAATAATGCCTGGGCCTATGCTACAAACTTTGTCCCCGGAAAGTGA
Predicted protein sequences of Glyma.16g162600
>Glyma.16g162600.1.p sequence-type=predicted peptide transcript=Glyma.16g162600.1 locus=Glyma.16g162600 ID=Glyma.16g162600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
DVDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo