Report for Sequence Feature Glyma.16g150800
| Feature Type: | gene_model |
| Chromosome: | Gm16 |
| Start: | 31309978 |
| stop: | 31315462 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.16g150800
Gene model name correspondences to Glyma.16g150800 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.16g150800
>Glyma.16g150800.1 sequence-type=CDS polypeptide=Glyma.16g150800.1.p locus=Glyma.16g150800 id=Glyma.16g150800.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGACGCGAGCTTCCACAAGCTCCACATCAAAAAGCTCAGCATCGGAGACGTTCAACGCCTCGAGTGGGAGCAGTTTGAGAACAAAATCAGACACTGGATAAAAGCCGCCAAGGTCTGCGTTAGAATTCTCTTCGCAAGCGAGAAGAAGCTCTGCGAGCAAATCTTCGACAACATCGGAACTTCCATCGACAATGCTTGCTTCATGGAGACAGTGAAATATCCTGCGATTCAGCTCTTCAAGAGAATATCTACGAACCATAAGAGAACAAGAATCCCACCATCCTTTATTTGA
Predicted protein sequences of Glyma.16g150800
>Glyma.16g150800.1.p sequence-type=predicted peptide transcript=Glyma.16g150800.1 locus=Glyma.16g150800 id=Glyma.16g150800.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MDASFHKLHIKKLSIGDVQRLEWEQFENKIRHWIKAAKVCVRILFASEKKLCEQIFDNIGTSIDNACFMETVKYPAIQLFKRISTNHKRTRIPPSFI*