Glyma.16g150700

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.16g150700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.16g150700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.16g150700

Feature Type:	gene_model
Chromosome:	Gm16
Start:	31109999
stop:	31114963
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.16g150700

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G65480.1	AT	PEBP (phosphatidylethanolamine-binding protein) family protein	JGI	N/A	IEA
GO:0009909	GO-bp	regulation of flower development	EnsemblGenomes	N/A	IEA
GO:0048573	GO-bp	photoperiodism, flowering	EnsemblGenomes	N/A	IEA
GO:0008429	GO-mf	phosphatidylethanolamine binding	EnsemblGenomes	N/A	IEA
KOG3346	KOG	Phosphatidylethanolamine binding protein	JGI	N/A	IEA
PTHR11362	Panther	PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN	JGI	N/A	IEA
PF01161	PFAM	Phosphatidylethanolamine-binding protein	JGI	N/A	IEA

Proteins Associated with Glyma.16g150700

Locus	Gene Symbol	Protein Name
E9	E9-1	E9 gene 1
	FT2a	Flowering locus T gene 2a
	FTL3	Flowering locus T-like gene 3
	FT2A	phosphatidylethanolamine-binding protein FT2a
	FT2a (E9)	Flowering Locus T gene 2a
	FT2a	Flowering Locus T2 gene a

Expression Patterns of Glyma.16g150700

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.16g150700 not represented in the dataset	Glyma.16g150700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.16g150700 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma16g26660	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.16g150700

Limit To All Plant Sequences

>Glyma.16g150700.1 sequence-type=CDS polypeptide=Glyma.16g150700.1.p locus=Glyma.16g150700 ID=Glyma.16g150700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCCTAGTGGAAGTAGGGATCCTCTCGTTGTTGGGGGAGTAATTGGGGATGTATTGGATCCTTTTGAATATTCTATTCCTATGAGGGTTACCTACAATAACAGAGATGTCAGCAATGGATGTGAATTCAAACCCTCACAAGTTGTCAACCAACCAAGGGTAAATATCGGTGGTGATGACCTCAGGAACTTCTATACTTTGATTGCGGTTGATCCCGATGCACCTAGCCCAAGTGACCCCAATTTGAGAGAATACCTCCATTGGTTGGTGACTGATATCCCAGCAACAACAGGGGCTAGTTTCGGCCATGAGGTTGTAACATATGAAAGTCCAAGACCAATGATGGGGATTCATCGTTTGGTGTTTGTGTTATTTCGTCAACTGGGTAGGGAGACCGTGTATGCACCAGGATGGCGCCAGAATTTCAACACTAAAGAATTTGCTGAACTTTACAACCTTGGATTGCCAGTTGCTGCTGTCTATTTCAACATTCAGAGGGAATCTGGTTCTGGTGGAAGGAGGTTATACTAA

Predicted protein sequences of Glyma.16g150700

Limit To All Plant Sequences

>Glyma.16g150700.1.p sequence-type=predicted peptide transcript=Glyma.16g150700.1 locus=Glyma.16g150700 ID=Glyma.16g150700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MPSGSRDPLVVGGVIGDVLDPFEYSIPMRVTYNNRDVSNGCEFKPSQVVNQPRVNIGGDDLRNFYTLIAVDPDAPSPSDPNLREYLHWLVTDIPATTGASFGHEVVTYESPRPMMGIHRLVFVLFRQLGRETVYAPGWRQNFNTKEFAELYNLGLPVAAVYFNIQRESGSGGRRLY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain