Report for Sequence Feature Glyma.16g118200
| Feature Type: | gene_model |
| Chromosome: | Gm16 |
| Start: | 26539156 |
| stop: | 26540310 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.16g118200
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| PF03101 | Pfam |
FAR1 DNA-binding domain |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.16g118200 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma16g22516 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.16g118200
>Glyma.16g118200.1 sequence-type=CDS polypeptide=Glyma.16g118200.1.p locus=Glyma.16g118200 id=Glyma.16g118200.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGAAGAAGACTATGGTGTTGGATAGTGGGTCACCGTTGATAAGCTTCGATTCGATGGTAGACATTTACAATATAGACATGCATAATCTAACGAATGATGAAGTTGAACATTTGGATTTTTTGGATTGGGAGATGGCTTGGTATTCTCGACTTATTGGGTTTTCTGTACGCAAAAGCCATGCTGTGAGGTCCCAATTTGGTGAGATAGTGCAACAAACATTTCTATGCTCACGTGGACTGAGGGAGGATACAGGTTTGACTTAG
Predicted protein sequences of Glyma.16g118200
>Glyma.16g118200.1.p sequence-type=predicted peptide transcript=Glyma.16g118200.1 locus=Glyma.16g118200 id=Glyma.16g118200.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MKKTMVLDSGSPLISFDSMVDIYNIDMHNLTNDEVEHLDFLDWEMAWYSRLIGFSVRKSHAVRSQFGEIVQQTFLCSRGLREDTGLT*