Glyma.16g108000

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.16g108000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.16g108000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.16g108000

Feature Type:	gene_model
Chromosome:	Gm16
Start:	21969989
stop:	21970757
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.16g108000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G42260.1	AT	beta glucosidase 12	JGI	N/A	IEA
GO:0005975	GO-bp	carbohydrate metabolic process	EnsemblGenomes	N/A	IEA
GO:0005975	GO-bp	carbohydrate metabolic process	JGI	N/A	IEA
GO:0009651	GO-bp	response to salt stress	EnsemblGenomes	N/A	IEA
GO:0009725	GO-bp	response to hormone	EnsemblGenomes	N/A	IEA
GO:0019762	GO-bp	glucosinolate catabolic process	EnsemblGenomes	N/A	IEA
GO:0004553	GO-mf	hydrolase activity, hydrolyzing O-glycosyl compounds	EnsemblGenomes	N/A	IEA
GO:0004553	GO-mf	hydrolase activity, hydrolyzing O-glycosyl compounds	JGI	N/A	IEA
GO:0008422	GO-mf	beta-glucosidase activity	EnsemblGenomes	N/A	IEA
PTHR10353	Panther	GLYCOSYL HYDROLASE	JGI	N/A	IEA
PF00232	PFAM	Glycosyl hydrolase family 1	JGI	N/A	IEA
GN7V-46148	SoyCyc9-rxn	β-glucosidase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.16g108000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.16g108000 not represented in the dataset	Glyma.16g108000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.16g108000 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma16g17075	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.16g108000

Limit To All Plant Sequences

>Glyma.16g108000.1 sequence-type=CDS polypeptide=Glyma.16g108000.1.p locus=Glyma.16g108000 ID=Glyma.16g108000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
TTCCATTGGGACGTTCCCCAAGCCTTAGAGGATGAGTATGGTGGTTTTTTAAGCCCTCACATTGTAGATGATTTTAGGAACTATGCTGAACTTTGCTTCAAGGAATTTGGCAATGGGGTGAAACATTGGATTACTTTGAATGAACCTAGGAGTGTGAGCAAGAATGGCTATGCAAATGGCAAGTTTGCACCTGGTCAGTGTTCTGATTGGCTAAAACTGAATTGCACAGGTGGTGATTCCGGAACTGAGCCCCATTTGACTTGGCGCTACCAACTTCTTGCTCATGCTACAACAGCCAAACTGTATAAGACCAAGTATCAGGCATCTCAAAAGGGTTTAATAGGGATTACCTTGAATTCTGACTGGTATATGCCGGTTTCTAAAGAGAAATCTGATCGAGACGCTGCACGTAGGGGCCTTGACTTCATGTTTGGA

Predicted protein sequences of Glyma.16g108000

Limit To All Plant Sequences

>Glyma.16g108000.1.p sequence-type=predicted peptide transcript=Glyma.16g108000.1 locus=Glyma.16g108000 ID=Glyma.16g108000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
FHWDVPQALEDEYGGFLSPHIVDDFRNYAELCFKEFGNGVKHWITLNEPRSVSKNGYANGKFAPGQCSDWLKLNCTGGDSGTEPHLTWRYQLLAHATTAKLYKTKYQASQKGLIGITLNSDWYMPVSKEKSDRDAARRGLDFMFG

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain