|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G71790.1 | AT | Subunits of heterodimeric actin filament capping protein Capz superfamily | JGI | N/A | IEA |
GO:0000902 | GO-bp | cell morphogenesis | EnsemblGenomes | N/A | IEA |
GO:0030036 | GO-bp | actin cytoskeleton organization | EnsemblGenomes | N/A | IEA |
GO:0030036 | GO-bp | actin cytoskeleton organization | JGI | N/A | IEA |
GO:0051016 | GO-bp | barbed-end actin filament capping | EnsemblGenomes | N/A | IEA |
GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
GO:0005884 | GO-cc | actin filament | EnsemblGenomes | N/A | IEA |
GO:0008290 | GO-cc | F-actin capping protein complex | EnsemblGenomes | N/A | IEA |
GO:0008290 | GO-cc | F-actin capping protein complex | JGI | N/A | IEA |
GO:0071203 | GO-cc | WASH complex | JGI | N/A | IEA |
GO:0003779 | GO-mf | actin binding | EnsemblGenomes | N/A | IEA |
GO:0003779 | GO-mf | actin binding | JGI | N/A | IEA |
GO:0051015 | GO-mf | actin filament binding | EnsemblGenomes | N/A | IEA |
PF01115 | PFAM | F-actin capping protein, beta subunit | JGI | N/A | IEA |
Glyma.16g101900 not represented in the dataset |
Glyma.16g101900 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma16g18075 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.16g101900.1 sequence-type=CDS polypeptide=Glyma.16g101900.1.p locus=Glyma.16g101900 ID=Glyma.16g101900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTGGAGGATTCCACCGAAACACGCAGAAACAGCTCTATCTGCACTTTTGAGCCTTATGCCTCATAGCTCCTCCAAGCTCCTCTCTCAAGTTTTGTGCAATGTGGAATGTGACAAGGAGTTCATTTTGTGCGAATACAATAGAGATGTCGACTCTTACAAGTTCATTTCATTTTTCATAATCATCCCTCCTGTATCTGGTTTTTGCTGGATTCAATATGCTTAA
>Glyma.16g101900.1.p sequence-type=predicted peptide transcript=Glyma.16g101900.1 locus=Glyma.16g101900 ID=Glyma.16g101900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MWRIPPKHAETALSALLSLMPHSSSKLLSQVLCNVECDKEFILCEYNRDVDSYKFISFFIIIPPVSGFCWIQYA*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||