|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G09920.1 | AT | RNA polymerase II, Rpb4, core protein | JGI | N/A | IEA |
| GO:0000288 | GO-bp | nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay | EnsemblGenomes | N/A | IEA |
| GO:0006351 | GO-bp | transcription, DNA-templated | EnsemblGenomes | N/A | IEA |
| GO:0006351 | GO-bp | transcription, DNA-templated | JGI | N/A | IEA |
| GO:0006352 | GO-bp | DNA-templated transcription, initiation | EnsemblGenomes | N/A | IEA |
| GO:0006367 | GO-bp | transcription initiation from RNA polymerase II promoter | EnsemblGenomes | N/A | IEA |
| GO:0031990 | GO-bp | mRNA export from nucleus in response to heat stress | EnsemblGenomes | N/A | IEA |
| GO:0034402 | GO-bp | recruitment of 3'-end processing factors to RNA polymerase II holoenzyme complex | EnsemblGenomes | N/A | IEA |
| GO:0044237 | GO-bp | cellular metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0045948 | GO-bp | positive regulation of translational initiation | EnsemblGenomes | N/A | IEA |
| GO:0000932 | GO-cc | P-body | EnsemblGenomes | N/A | IEA |
| GO:0005665 | GO-cc | DNA-directed RNA polymerase II, core complex | EnsemblGenomes | N/A | IEA |
| GO:0030880 | GO-cc | RNA polymerase complex | EnsemblGenomes | N/A | IEA |
| GO:0055029 | GO-cc | nuclear DNA-directed RNA polymerase complex | EnsemblGenomes | N/A | IEA |
| GO:0000166 | GO-mf | nucleotide binding | EnsemblGenomes | N/A | IEA |
| GO:0003697 | GO-mf | single-stranded DNA binding | EnsemblGenomes | N/A | IEA |
| GO:0003727 | GO-mf | single-stranded RNA binding | EnsemblGenomes | N/A | IEA |
| GO:0003824 | GO-mf | catalytic activity | EnsemblGenomes | N/A | IEA |
| GO:0003899 | GO-mf | DNA-directed 5'-3' RNA polymerase activity | EnsemblGenomes | N/A | IEA |
| GO:0003899 | GO-mf | DNA-directed RNA polymerase activity | JGI | N/A | IEA |
| GO:0031369 | GO-mf | translation initiation factor binding | EnsemblGenomes | N/A | IEA |
| KOG2351 | KOG | RNA polymerase II, fourth largest subunit | JGI | N/A | IEA |
| PTHR21297 | Panther | DNA-DIRECTED RNA POLYMERASE II | JGI | N/A | IEA |
| PF03874 | PFAM | RNA polymerase Rpb4 | JGI | N/A | IEA |
|
Glyma.16g084800 not represented in the dataset |
Glyma.16g084800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.03g088500 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma16g09890 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.16g084800.1 sequence-type=CDS polypeptide=Glyma.16g084800.1.p locus=Glyma.16g084800 ID=Glyma.16g084800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTCCGGGGAAGAGGAAGAAAACGCCGCAGAGCTCAAAATTGGAGACGAGTTTTTGAAGGCAAAGTGCTTAATGAACTGTGAAGTTTCATTGATTCTTGAGCACAAGTATGAGCAGCTTCAACAGACATCTGATGATCCCATGAATCAAATTTCTCAGGTATTTGAAAAGTCACTGCAGTATGTGAAACGTTTCAGTCGCTATAAAAATCCTGATGCTGTCAGACAAGTTCGAGAAATTCTCGCAAGATATCAATTGGCTGAGTTTGAGTTGTGTGTCCTTGGCAACCTTTGCCCAGAAACTGTGGAGGAAGCTATTGCTATGGTTCCATCTATCAAGTCAAGAGGACGAGCTCAGGATGATGAAGCAATCGAGAAAATGTTAAATGACCTGTCGTTGATTAAGAAATTTGAATAA
>Glyma.16g084800.1.p sequence-type=predicted peptide transcript=Glyma.16g084800.1 locus=Glyma.16g084800 ID=Glyma.16g084800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MSGEEEENAAELKIGDEFLKAKCLMNCEVSLILEHKYEQLQQTSDDPMNQISQVFEKSLQYVKRFSRYKNPDAVRQVREILARYQLAEFELCVLGNLCPETVEEAIAMVPSIKSRGRAQDDEAIEKMLNDLSLIKKFE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||