SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.16g059000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.16g059000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.16g059000

Feature Type:gene_model
Chromosome:Gm16
Start:5772754
stop:5778684
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01850.1AT Aldolase-type TIM barrel family protein JGI N/AIEA
GO:0005975GO-bp carbohydrate metabolic process EnsemblGenomesN/AIEA
GO:0005975GO-bp carbohydrate metabolic process JGI N/AIEA
GO:0006098GO-bp pentose-phosphate shunt EnsemblGenomesN/AIEA
GO:0008152GO-bp metabolic process EnsemblGenomesN/AIEA
GO:0009052GO-bp pentose-phosphate shunt, non-oxidative branch EnsemblGenomesN/AIEA
GO:0019323GO-bp pentose catabolic process EnsemblGenomesN/AIEA
GO:0044262GO-bp cellular carbohydrate metabolic process EnsemblGenomesN/AIEA
GO:0005829GO-cc cytosol EnsemblGenomesN/AIEA
GO:0003824GO-mf catalytic activity EnsemblGenomesN/AIEA
GO:0004750GO-mf ribulose-phosphate 3-epimerase activity EnsemblGenomesN/AIEA
GO:0016853GO-mf isomerase activity EnsemblGenomesN/AIEA
GO:0016857GO-mf racemase and epimerase activity, acting on carbohydrates and derivatives EnsemblGenomesN/AIEA
GO:0016857GO-mf racemase and epimerase activity, acting on carbohydrates and derivatives JGI N/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
KOG3111 KOG D-ribulose-5-phosphate 3-epimerase JGI N/AIEA
PTHR11749Panther RIBULOSE-5-PHOSPHATE-3-EPIMERASE JGI N/AIEA
PF00834PFAM Ribulose-phosphate 3 epimerase family JGI N/AIEA
CALVIN-PWYSoyCyc9 Calvin-Benson-Bassham cycle Plant Metabolic Network ISS
NONOXIPENT-PWYSoyCyc9 pentose phosphate pathway (non-oxidative branch) Plant Metabolic Network ISS
PENTOSE-P-PWYSoyCyc9 pentose phosphate pathway Plant Metabolic Network ISS
PHOTOALL-PWYSoyCyc9 oxygenic photosynthesis Plant Metabolic Network ISS
PWY-5723SoyCyc9 Rubisco shunt Plant Metabolic Network ISS
GN7V-44965SoyCyc9-rxn ribulose-phosphate 3-epimerase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.16g059000 not represented in the dataset

Glyma.16g059000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.19g088400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma16g06360 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.16g059000.1 sequence-type=CDS polypeptide=Glyma.16g059000.1.p locus=Glyma.16g059000 ID=Glyma.16g059000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGAATGACACCGAAAATAGCTCCTTCGATGCTCTCTTCCGACTTCGCCAATTTGGCTTCCGAGGCTCAGCGCATGCTCCACTTCGGCGCCGATTGGCTCCACATGGACATCATGGATGGGCATTTTGTCCCCAATTTAACTATTGGCGCTCCAGTTATTGAAAGTTTGAGAAAGCACACAAAGGCATATTTGGATTGTCACCTTATGGTTACAAATCCTCTTGATTATGTTGAACCCTTGGCAAAAGCTGGTGCTTCTGGTTTTACATTTCACGTAGAGACATCAAAAGATAACTGGAAAGAACTTATCCAAAGAATCAAGTCACATGGCATGATTCCTGGTGTAGCATTAAAGCCTGGGACCCCCGTTGGAGAGGTTTATCCTCTGGTGGAAGCCGAAAATCCTGTGGAAATGGTTCTTGTGATGACTGTAGAACCTGGATTCGGAGGACAAAAATTTATGGCAGAGACGATGGATAAAGTACGTATACTTAGGAAGAAGTATCCATCACTTGACATAGAGGTTGATGGTGGTTTAGGGCCTTCAACCATAGACGTGGCCGCATCAGCAGGGGCAAATTGCATTGTTGCTGGAAGTTCTGTTTTTGGTGCACCTGAGCCAGCTCAAGTAATATCCTTACTGAGGAGTTCTGTTGAGAAAGCCCAGCAAACCTCGATACAGTAA

>Glyma.16g059000.1.p sequence-type=predicted peptide transcript=Glyma.16g059000.1 locus=Glyma.16g059000 ID=Glyma.16g059000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGMTPKIAPSMLSSDFANLASEAQRMLHFGADWLHMDIMDGHFVPNLTIGAPVIESLRKHTKAYLDCHLMVTNPLDYVEPLAKAGASGFTFHVETSKDNWKELIQRIKSHGMIPGVALKPGTPVGEVYPLVEAENPVEMVLVMTVEPGFGGQKFMAETMDKVRILRKKYPSLDIEVDGGLGPSTIDVAASAGANCIVAGSSVFGAPEPAQVISLLRSSVEKAQQTSIQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo