Report for Sequence Feature Glyma.16g058600
| Feature Type: | gene_model |
| Chromosome: | Gm16 |
| Start: | 5734331 |
| stop: | 5735487 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Gene model name correspondences to Glyma.16g058600 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.16g058600
>Glyma.16g058600.1 sequence-type=CDS polypeptide=Glyma.16g058600.1.p locus=Glyma.16g058600 id=Glyma.16g058600.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGTACATTTATTAGAGACTCAGCAGAGCAAGGAAGAGGATCACTTTTCAGATATAATGTTATGGCTAAAGCAAAATAAAGCAAAACGTTCAATCTGTGAAACGGTATGTGCTGTTGGTAAGATAACTTGGTCGATTTTGAAGCTTCAAGATGCCCCCCCTGCATTTAAGGAACATGTGATTTTGATGATTGGTAGCTAA
Predicted protein sequences of Glyma.16g058600
>Glyma.16g058600.1.p sequence-type=predicted peptide transcript=Glyma.16g058600.1 locus=Glyma.16g058600 id=Glyma.16g058600.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MVHLLETQQSKEEDHFSDIMLWLKQNKAKRSICETVCAVGKITWSILKLQDAPPAFKEHVILMIGS*