Glyma.16g026300

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.16g026300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.16g026300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.16g026300

Feature Type:	gene_model
Chromosome:	Gm16
Start:	2548459
stop:	2551597
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.16g026300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G01370.1	AT	Histone superfamily protein	JGI	N/A	IEA
GO:0006334	GO-bp	nucleosome assembly	EnsemblGenomes	N/A	IEA
GO:0000786	GO-cc	nucleosome	EnsemblGenomes	N/A	IEA
GO:0005634	GO-cc	nucleus	EnsemblGenomes	N/A	IEA
GO:0005694	GO-cc	chromosome	EnsemblGenomes	N/A	IEA
GO:0003677	GO-mf	DNA binding	EnsemblGenomes	N/A	IEA
GO:0003677	GO-mf	DNA binding	JGI	N/A	IEA
GO:0031492	GO-mf	nucleosomal DNA binding	EnsemblGenomes	N/A	IEA
GO:0046982	GO-mf	protein heterodimerization activity	EnsemblGenomes	N/A	IEA
KOG1745	KOG	Histones H3 and H4	JGI	N/A	IEA
PTHR11426	Panther	HISTONE H3	JGI	N/A	IEA
PTHR11426:SF4	Panther		JGI	N/A	IEA
PF00125	PFAM	Core histone H2A/H2B/H3/H4	JGI	N/A	IEA

Expression Patterns of Glyma.16g026300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.16g026300 not represented in the dataset	Glyma.16g026300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.16g026300

Paralog	Evidence	Comments
Glyma.07g057300	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.16g026300 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments

Coding sequences of Glyma.16g026300

Limit To All Plant Sequences

>Glyma.16g026300.1 sequence-type=CDS polypeptide=Glyma.16g026300.1.p locus=Glyma.16g026300 ID=Glyma.16g026300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGAGAGTGAAGCACACGCCAGCTTCTCGCAAATCCGGTAAAAAAAAAGCGCCACGCGCATCCACGTCCACGCAGCCATCACTATCATCATCCCAATCGACTCAGGGAAGGAAAAAGATGCGCAATAGGCAGGGCACTGTGGCGCTTCGTGAGATTCGGCATCTTCAGAGGAGTTGTGAGCTTCTTATCCCGGCTGCTCCCTTTATCAGATGTGTTAAACAAATTACAAATCAATTCTCCTCAGAGGTGTCTCGTTGGACACCTGAAGCTGTGGTGGCACTTCAGGAGATTAGCGGGCGCTATAGTGTATTAGCAGAGCAGAGAGGCCCTGGACTGCTATGGAATTCAAAAAGCAGAGCAGTTTTTAATAGCAACCACAATCTGAGATTGATAATTATGCAAAGATCTTGTGTTATTAACTGGTTTATGTTTTTCCATTTGAAAAAGGATATCGAGTTGGCCCGGAGGCTTGGAGGAATAGGAAGGCCTTGGTGA

Predicted protein sequences of Glyma.16g026300

Limit To All Plant Sequences

>Glyma.16g026300.1.p sequence-type=predicted peptide transcript=Glyma.16g026300.1 locus=Glyma.16g026300 ID=Glyma.16g026300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MARVKHTPASRKSGKKKAPRASTSTQPSLSSSQSTQGRKKMRNRQGTVALREIRHLQRSCELLIPAAPFIRCVKQITNQFSSEVSRWTPEAVVALQEISGRYSVLAEQRGPGLLWNSKSRAVFNSNHNLRLIIMQRSCVINWFMFFHLKKDIELARRLGGIGRPW*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain