SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.16G151800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.16G151800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.16G151800

Feature Type:gene_model
Chromosome:Gm16
Start:31225865
stop:31230698
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G23220.1AT Dynein light chain type 1 family protein JGI N/AIEA
GO:0007017GO-bp microtubule-based process EnsemblGenomesN/AIEA
GO:0007017GO-bp microtubule-based process JGI N/AIEA
GO:0010970GO-bp transport along microtubule EnsemblGenomesN/AIEA
GO:0060271GO-bp cilium assembly EnsemblGenomesN/AIEA
GO:2000582GO-bp positive regulation of ATP-dependent microtubule motor activity, plus-end-directed EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0005856GO-cc cytoskeleton EnsemblGenomesN/AIEA
GO:0005868GO-cc cytoplasmic dynein complex EnsemblGenomesN/AIEA
GO:0005874GO-cc microtubule EnsemblGenomesN/AIEA
GO:0005875GO-cc microtubule associated complex JGI N/AIEA
GO:0030286GO-cc dynein complex EnsemblGenomesN/AIEA
GO:0003774GO-mf motor activity EnsemblGenomesN/AIEA
GO:0008092GO-mf cytoskeletal protein binding EnsemblGenomesN/AIEA
GO:0008574GO-mf ATP-dependent microtubule motor activity, plus-end-directed EnsemblGenomesN/AIEA
GO:0045505GO-mf dynein intermediate chain binding EnsemblGenomesN/AIEA
GO:0051959GO-mf dynein light intermediate chain binding EnsemblGenomesN/AIEA
KOG3430 KOG Dynein light chain type 1 JGI N/AIEA
PTHR11886Panther DYNEIN LIGHT CHAIN JGI N/AIEA
PTHR11886:SF9Panther JGI N/AIEA
PF01221PFAM Dynein light chain type 1 JGI N/AIEA
GN7V-65220SoyCyc9-rxn dynein ATPase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.16G151800 not represented in the dataset

Glyma.16G151800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.02g070300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g151800 Wm82.a4.v1ISS As supplied by JGI
Glyma16g26790 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.16g151800.1 sequence-type=CDS polypeptide=Glyma.16g151800.1.p locus=Glyma.16g151800 ID=Glyma.16g151800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAAGAAGCAGAGAAAGAGTTAGAGAGAAGGAGCAAGTTTCTGAACAGTTTGATACAGAAGAAGAAGAAAGGCATAGAGCAGCATGAACATGAGAGTTTCAAGGTTCATGTCAGAGCTTGTGACATGCCCCTCCCTTTGCAGAACCGCGCCTTACAATGCGCACGTCTTCACTTGGAATCTATGCCACCTGGCAACAAGCTTGACAACAAACGCCTTGCACTGGCCCTTAAGAAGGAATTTGATTCTTCGTATGGTCCAGCTTGGCACTGCATTGTGGGTACTAGCTTTGGTTCTTATGTTACACATTCTGTTGGTGGCTTTTTGTACTTTTCCATTGATAAGGTTTATATCCTTCTCTTCAAGACAGCTGTTGAACCATTGGACCATTGA

>Glyma.16g151800.1.p sequence-type=predicted peptide transcript=Glyma.16g151800.1 locus=Glyma.16g151800 ID=Glyma.16g151800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEEAEKELERRSKFLNSLIQKKKKGIEQHEHESFKVHVRACDMPLPLQNRALQCARLHLESMPPGNKLDNKRLALALKKEFDSSYGPAWHCIVGTSFGSYVTHSVGGFLYFSIDKVYILLFKTAVEPLDH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo