SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.16G130300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.16G130300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.16G130300

Feature Type:gene_model
Chromosome:Gm16
Start:28381466
stop:28384134
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34720.1AT ATPase, F0/V0 complex, subunit C protein JGI N/AIEA
GO:0006811GO-bp ion transport EnsemblGenomesN/AIEA
GO:0007035GO-bp vacuolar acidification EnsemblGenomesN/AIEA
GO:0015991GO-bp ATP hydrolysis coupled proton transport EnsemblGenomesN/AIEA
GO:0015991GO-bp ATP hydrolysis coupled proton transport JGI N/AIEA
GO:0000220GO-cc vacuolar proton-transporting V-type ATPase, V0 domain EnsemblGenomesN/AIEA
GO:0005773GO-cc vacuole EnsemblGenomesN/AIEA
GO:0005774GO-cc vacuolar membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0033177GO-cc proton-transporting two-sector ATPase complex, proton-transporting domain EnsemblGenomesN/AIEA
GO:0033177GO-cc proton-transporting two-sector ATPase complex, proton-transporting domain JGI N/AIEA
GO:0033179GO-cc proton-transporting V-type ATPase, V0 domain EnsemblGenomesN/AIEA
GO:0015078GO-mf proton transmembrane transporter activity EnsemblGenomesN/AIEA
GO:0015078GO-mf hydrogen ion transmembrane transporter activity JGI N/AIEA
GO:0046961GO-mf proton-transporting ATPase activity, rotational mechanism EnsemblGenomesN/AIEA
KOG0232 KOG Vacuolar H+-ATPase V0 sector, subunits c/c' JGI N/AIEA
PTHR10263Panther V-TYPE PROTON ATPASE PROTEOLIPID SUBUNIT JGI N/AIEA
PF00137PFAM ATP synthase subunit C JGI N/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.16G130300 not represented in the dataset

Glyma.16G130300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.02g050200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g130300 Wm82.a4.v1ISS As supplied by JGI
Glyma16g24220 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.16g130300.1 sequence-type=CDS polypeptide=Glyma.16g130300.1.p locus=Glyma.16g130300 ID=Glyma.16g130300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTGCCTTCAGCGGCGACGAAACCGCACCTTTCTTTGGCTTCCTCGGAGCCGCCGCTGCCCTCGTTTTTTCCTGTATGGGAGCGGCGTACGGAACCGCGAAGAGCGGCGTCGGGGTTGCGTCGATGGGCGTGATGAGGCCGGAGCTGGTGATGAAATCGATCGTGCCGGTTGTGATGGCTGGTGTGTTGGGTATCTACGGTTTGATCATTGCGGTTATCATAAGTACGGGCATTAACCCTAAGGCCAAATCGTACTATCTTTTTGACGGCTACGCCCACCTCTCTTCAGGTCTCGCTTGTGGCCTCGCTGGCCTCTCCGCTGGCATGGCCATCGGCATCGTTGGCGATGCCGGTGTTAGAGCAAATGCTCAGCAGCCAAAGCTTTTTGTTGGAATGATACTCATCCTCATTTTTGCTGAGGCGTTGGCATTATACGGTCTCATTGTTGGCATCATCCTCTCTTCTCGTGCTGGCCAATCCAGGGCTGACTAA

>Glyma.16g130300.1.p sequence-type=predicted peptide transcript=Glyma.16g130300.1 locus=Glyma.16g130300 ID=Glyma.16g130300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo