Report for Sequence Feature Glyma.15g272500
| Feature Type: | gene_model |
| Chromosome: | Gm15 |
| Start: | 52983657 |
| stop: | 52984226 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.15g272500
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| PTHR33659 | PantherFam |
PROTEIN, PUTATIVE-RELATED-RELATED |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.15g272500 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma15g42762 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.15g272500
>Glyma.15g272500.1 sequence-type=CDS polypeptide=Glyma.15g272500.1.p locus=Glyma.15g272500 id=Glyma.15g272500.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGCATCTCAAGCAACCTCTTTCAAGTCCTTTGTCATTGCTCTTATTGTGGCGCTTTTCTTCGCCGCCGCCACCGCTCAAGATTTGTCTCCGGCGCCTGCGCAGGGACCCGATGTCGGAGTTGCCGGATCCGTTTCGAGTTCGATGGCCGTGATTGGAGCTTCGGTCGTGTTGTCAATGTTCGCCATCTTCAAGCACTGA
Predicted protein sequences of Glyma.15g272500
>Glyma.15g272500.1.p sequence-type=predicted peptide transcript=Glyma.15g272500.1 locus=Glyma.15g272500 id=Glyma.15g272500.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MASQATSFKSFVIALIVALFFAAATAQDLSPAPAQGPDVGVAGSVSSSMAVIGASVVLSMFAIFKH*