|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G12250.1 | AT | beta-6 tubulin | JGI | N/A | IEA |
| GO:0007010 | GO-bp | cytoskeleton organization | EnsemblGenomes | N/A | IEA |
| GO:0007017 | GO-bp | microtubule-based process | EnsemblGenomes | N/A | IEA |
| GO:0005874 | GO-cc | microtubule | EnsemblGenomes | N/A | IEA |
| GO:0000166 | GO-mf | nucleotide binding | EnsemblGenomes | N/A | IEA |
| GO:0003924 | GO-mf | GTPase activity | EnsemblGenomes | N/A | IEA |
| GO:0005200 | GO-mf | structural constituent of cytoskeleton | EnsemblGenomes | N/A | IEA |
| GO:0005525 | GO-mf | GTP binding | EnsemblGenomes | N/A | IEA |
| PTHR11588 | Panther | TUBULIN | JGI | N/A | IEA |
| PF00091 | PFAM | Tubulin/FtsZ family, GTPase domain | JGI | N/A | IEA |
| GN7V-66752 | SoyCyc9-rxn | purine-nucleoside phosphorylase | Plant Metabolic Network | ISS |
|
Glyma.15g263900 not represented in the dataset |
Glyma.15g263900 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma15g41795 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.15g263900.1 sequence-type=CDS polypeptide=Glyma.15g263900.1.p locus=Glyma.15g263900 ID=Glyma.15g263900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 TTGAGGCCTGATAATTTCGTGTTCGGCCAAAATGGAGCTGGTAACAACTGGGTTAAAGGGCATTATACTGAGGGAGCTGAGCTTATTGATTTTGTTCTTGATGTTGTTCGAAAAGAAGCTGAGAACTATGACTGCTTGCAGGGGTTGCAAATTTTTCACTCACTGGGAGGAGGAACTGGGTCTGGAATGGGTACCTTGCTTATCTCAAAGATCAGAGAAGAGTATCCGGATAGGATGATGTTGACATTCTTAGTGTTCTTATCTCCAAAGGTCTCTAACACCGTGGTTGAATCCTACAATGCCACTCTCTCTATTCATCAACTAGTTGATATTACTAATGAATGCATGGTCCTTGATAATGAGGCACTTTATGATATCTGTGTTTGTACACTCAAGCTCACAAATCCAAGT
>Glyma.15g263900.1.p sequence-type=predicted peptide transcript=Glyma.15g263900.1 locus=Glyma.15g263900 ID=Glyma.15g263900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 LRPDNFVFGQNGAGNNWVKGHYTEGAELIDFVLDVVRKEAENYDCLQGLQIFHSLGGGTGSGMGTLLISKIREEYPDRMMLTFLVFLSPKVSNTVVESYNATLSIHQLVDITNECMVLDNEALYDICVCTLKLTNPS
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||