SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.15g261500

Feature Type:gene_model
Chromosome:Gm15
Start:49389257
stop:49390129
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.15g261500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G03170.1AT SKP1-like 14 JGI N/AIEA
GO:0006511GO-bp ubiquitin-dependent protein catabolic process EnsemblGenomesN/AIEA
GO:0006511GO-bp ubiquitin-dependent protein catabolic process JGI N/AIEA
KOG1724 KOG SCF ubiquitin ligase, Skp1 component JGI N/AIEA
PTHR11165Panther SKP1 JGI N/AIEA
PF01466PFAM Skp1 family, dimerisation domain JGI N/AIEA
PF03931PFAM Skp1 family, tetramerisation domain JGI N/AIEA

Expression Patterns of Glyma.15g261500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.15g261500 not represented in the dataset
Glyma.15g261500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.15g261500 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma15g41493 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.15g261500
>Glyma.15g261500.1 sequence-type=CDS polypeptide=Glyma.15g261500.1.p locus=Glyma.15g261500 ID=Glyma.15g261500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGAGAAAAAGGAGAATCATCCAAATCGGCTATGCTGAAGCATGCAGAGGAAGAAGAATTGAATACAAAAAGATTGAAAACTGTGGAGGGGGAAGAATCCAATATGGTAGAAGAAACAGAAAACATTAAGCTGAAAACTTCAGATGAAATCATCTTCGAGGTGGAACCCTCGATCGTGAAGGAGATGGTGACGATACAGACCTTCATCGAGGACAACAACAACGAAACTTCCATCCCCATTCCGCTCCCCAACGTCACCAGTAATACTCTCCGTCGAATCCTCGAGTTCAAAGCTCGAGGATTCGACGAAGAGTTCGTGAAGACGTTGGGCATGGACGAGGTTTTCGAACTGATCCTCGCTGCCAACTACCTCAACATGAAAACCCTCCTGGATATCCTGACTAAGATCATTGCAGACTTCATCAAGAATAAGAGCGTGGAGTTTGTTAGGAAGTTCTTCAACATCGTCAACGATTTCACACCCGAGGAAGAGGCCAAGATTCGTGAAGAAAATGCCTGGGCCTTTGAGGGATTTGAGTGCGATGATTGA
Predicted protein sequences of Glyma.15g261500
>Glyma.15g261500.1.p sequence-type=predicted peptide transcript=Glyma.15g261500.1 locus=Glyma.15g261500 ID=Glyma.15g261500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGEKGESSKSAMLKHAEEEELNTKRLKTVEGEESNMVEETENIKLKTSDEIIFEVEPSIVKEMVTIQTFIEDNNNETSIPIPLPNVTSNTLRRILEFKARGFDEEFVKTLGMDEVFELILAANYLNMKTLLDILTKIIADFIKNKSVEFVRKFFNIVNDFTPEEEAKIREENAWAFEGFECDD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo