Glyma.15g260000

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.15g260000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.15g260000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.15g260000

Feature Type:	gene_model
Chromosome:	Gm15
Start:	49225920
stop:	49236827
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.15g260000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G16470.1	AT	proteasome subunit PAB1	JGI	N/A	IEA
GO:0006508	GO-bp	proteolysis	EnsemblGenomes	N/A	IEA
GO:0006511	GO-bp	ubiquitin-dependent protein catabolic process	EnsemblGenomes	N/A	IEA
GO:0006511	GO-bp	ubiquitin-dependent protein catabolic process	JGI	N/A	IEA
GO:0051603	GO-bp	proteolysis involved in cellular protein catabolic process	EnsemblGenomes	N/A	IEA
GO:0051603	GO-bp	proteolysis involved in cellular protein catabolic process	JGI	N/A	IEA
GO:0000502	GO-cc	proteasome complex	EnsemblGenomes	N/A	IEA
GO:0005634	GO-cc	nucleus	EnsemblGenomes	N/A	IEA
GO:0005737	GO-cc	cytoplasm	EnsemblGenomes	N/A	IEA
GO:0005839	GO-cc	proteasome core complex	EnsemblGenomes	N/A	IEA
GO:0005839	GO-cc	proteasome core complex	JGI	N/A	IEA
GO:0019773	GO-cc	proteasome core complex, alpha-subunit complex	EnsemblGenomes	N/A	IEA
GO:0019773	GO-cc	proteasome core complex, alpha-subunit complex	JGI	N/A	IEA
GO:0004175	GO-mf	endopeptidase activity	EnsemblGenomes	N/A	IEA
GO:0004175	GO-mf	endopeptidase activity	JGI	N/A	IEA
GO:0004298	GO-mf	threonine-type endopeptidase activity	EnsemblGenomes	N/A	IEA
GO:0004298	GO-mf	threonine-type endopeptidase activity	JGI	N/A	IEA
GO:0008233	GO-mf	peptidase activity	EnsemblGenomes	N/A	IEA
GO:0016787	GO-mf	hydrolase activity	EnsemblGenomes	N/A	IEA
KOG0181	KOG	20S proteasome, regulatory subunit alpha type PSMA2/PRE8	JGI	N/A	IEA
PTHR11599	Panther	PROTEASOME SUBUNIT ALPHA/BETA	JGI	N/A	IEA
PTHR11599:SF16	Panther	PROTEASOME SUBUNIT ALPHA TYPE-2	JGI	N/A	IEA
PF00227	PFAM	Proteasome subunit	JGI	N/A	IEA
PF10584	PFAM	Proteasome subunit A N-terminal signature	JGI	N/A	IEA

Expression Patterns of Glyma.15g260000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.15g260000 not represented in the dataset	Glyma.15g260000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.15g260000

Paralog	Evidence	Comments
Glyma.08g167600	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.15g260000 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma15g41330	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.15g260000

Limit To All Plant Sequences

>Glyma.15g260000.1 sequence-type=CDS polypeptide=Glyma.15g260000.1.p locus=Glyma.15g260000 ID=Glyma.15g260000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGGGATAGTCAGTATTCGTTTTCTCTCACCACATTTAGCCCTTCTGGAAAGCTTGTTCAGATTGAGCATGCTTTGACGGCTGTTGGGTCTGGACAAACGTCTTTGGGAATTAAAGCTGCAAATGGAGTTGTCATTGCTACCGAGAAGAAATTACCATCTATATTGGTTGATGAAGCATCAGTCCAGAAAATTCAGTTATTAACACCAAATATAGGTGTCGTATATAGTGGCATGGGTCCCGATTTTCGAGTTTTGGTTCGAAAAAGCAGGAAACAAGCCGAGCAGTATCATCGGTTATATAAAGAACCAATTCCTGTCACTCAACTTGTCAGGGAAGTTGCCGCTGTAATGCAGGAATTTACTCAGTCTGGTGGTGTCAGGCCTTTTGGAGTGTCTCTGCTAGTTGCCGGGTTTGATGATAATGGGCCACAATTATATCAGGTGGATCCATCAGGTTCATATTTTTCTTGGAAAGCTTCTGCTATGGGGAAAAATGTTTCTAATGCAAAGACGTTTCTTGAGAAGAGGTACACAGATGATATGGAGCTTGATGATGCAGTCCACACAGCAATGTTGACTCTGAAGGAAGGGTTTGAGGGACAGATCTCAGGAAAAAACATTGAAATTGGCATAATTGGTGCTGATAAAAAGTTCAGGGTATTGACACCAGCTGAAATTGATGACTATTTGGCTGAAGTAGAATAA

Predicted protein sequences of Glyma.15g260000

Limit To All Plant Sequences

>Glyma.15g260000.1.p sequence-type=predicted peptide transcript=Glyma.15g260000.1 locus=Glyma.15g260000 ID=Glyma.15g260000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGDSQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKAANGVVIATEKKLPSILVDEASVQKIQLLTPNIGVVYSGMGPDFRVLVRKSRKQAEQYHRLYKEPIPVTQLVREVAAVMQEFTQSGGVRPFGVSLLVAGFDDNGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTDDMELDDAVHTAMLTLKEGFEGQISGKNIEIGIIGADKKFRVLTPAEIDDYLAEVE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain