Report for Sequence Feature Glyma.15g256300
| Feature Type: | gene_model |
| Chromosome: | Gm15 |
| Start: | 50540006 |
| stop: | 50541644 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.15g256300
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT2G32190.1 | AT |
|
JGI | N/A | IEA |
| PTHR31568 | PantherFam |
RCG49325, ISOFORM CRA_A |
JGI | N/A | IEA |
| PF12734 | Pfam |
Cysteine-rich TM module stress tolerance |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.15g256300 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma15g40790 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.15g256300
>Glyma.15g256300.3 sequence-type=CDS polypeptide=Glyma.15g256300.3.p locus=Glyma.15g256300 id=Glyma.15g256300.3.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGAATCACCAACAACAATCTCCTGTGACTGCATATCCAGCAGTGAGTCAGAGCAACCCAGCAGCTCCACCACCACCTGTGGGTTATCCCACAAAGGATGATGTTCCTTCCCAACAAAATGTTCCAATCAAAACCTCTACTAGGGGTGATGGCTTTTGGAAGGGATGTTGTGCTGGATTGTGCTGTTGCTGTGCCCTGGATTGTTGTCTCTGA
Predicted protein sequences of Glyma.15g256300
>Glyma.15g256300.3.p sequence-type=predicted peptide transcript=Glyma.15g256300.3 locus=Glyma.15g256300 id=Glyma.15g256300.3.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MNHQQQSPVTAYPAVSQSNPAAPPPPVGYPTKDDVPSQQNVPIKTSTRGDGFWKGCCAGLCCCCALDCCL*