Report for Sequence Feature Glyma.15g255800
Feature Type: gene_model
Chromosome: Gm15
Start: 48508359
stop: 48513281
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.15g255800
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G12930.1 AT
Lojap-related protein
JGI N/A IEA
GO:0017148 GO-bp
negative regulation of translation
EnsemblGenomes N/A IEA
GO:0090071 GO-bp
negative regulation of ribosome biogenesis
EnsemblGenomes N/A IEA
GO:0043023 GO-mf
ribosomal large subunit binding
EnsemblGenomes N/A IEA
PTHR21043 Panther
IOJAP SUPERFAMILY ORTHOLOG
JGI N/A IEA
PF02410 PFAM
Oligomerisation domain
JGI N/A IEA
Expression Patterns of Glyma.15g255800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.15g255800
Paralog Evidence Comments
Glyma.08g172200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.15g255800 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma15g40740 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.15g255800
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.15g255800.1 sequence-type=CDS polypeptide=Glyma.15g255800.1.p locus=Glyma.15g255800 ID=Glyma.15g255800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCTACCATCATCCACTGTCCTGTCTCTCGCCGGAACCGGCGCCGGCGTTCCGGTGAGCTTTTCCGGCAAACTGGGTCACCTCGAAACCAAGTTTTCTCCAAGACCCAGAAAGGTTTTCAGCCGTTCGTGCATAAAGGGGCTTCCTTTACAACAAAACACCGTCAATGGTTTAAAATCGAAGAAGAGAAACACACATTCGAGCTTCGCGTTGGGTAAAAATGCCGAAGACAGCTTTTTATCGGATGTAAATGGAGACACCGATGAGATGTACGATGAATTAATTAATAATTATGGAAAAGTGGTATTTAGTAGAAAAGACAAAAAGCCTGCTAGCGCAGAGATTGACGATGATGCTGAAAGCCTGTCATTTGCTGTGGAATTGGCCACGGTTGCAAGTGAGGTTAAGGCAGGAGATATAAAGGTCTTATTTGTGAAGCCACTTGTTTACTGGACTCGATTTTTTATCATAGCTACAGCATTTTCTCGTCCCCAGATTGATGCTATCGGGTCCAGAATTAGAGATCGAGCTGAGAAGAAATATGGAAAAATTCCAACCGGAGACACAAAACCCAACTCATGGACTCTGTTGGACTTCGGTGATGTTGTTGTCCACATCTTCCTTCCCTCACAGAGAGCTTTCTACAATTTGGAAGAATTTTATGGTAATGCAACACCAGTAGAGCTGCCTTTTGAAAATCAACCACCACCATTTCGCATTTGA
Predicted protein sequences of Glyma.15g255800
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.15g255800.1.p sequence-type=predicted peptide transcript=Glyma.15g255800.1 locus=Glyma.15g255800 ID=Glyma.15g255800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLPSSTVLSLAGTGAGVPVSFSGKLGHLETKFSPRPRKVFSRSCIKGLPLQQNTVNGLKSKKRNTHSSFALGKNAEDSFLSDVNGDTDEMYDELINNYGKVVFSRKDKKPASAEIDDDAESLSFAVELATVASEVKAGDIKVLFVKPLVYWTRFFIIATAFSRPQIDAIGSRIRDRAEKKYGKIPTGDTKPNSWTLLDFGDVVVHIFLPSQRAFYNLEEFYGNATPVELPFENQPPPFRI*