SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.15g250900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.15g250900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.15g250900

Feature Type:gene_model
Chromosome:Gm15
Start:47906601
stop:47907749
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.15g250900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G62000.1AT S-adenosyl-L-methionine-dependent methyltransferases superfamily protein JGI N/AIEA
GO:0032259GO-bp methylation EnsemblGenomesN/AIEA
GO:0008171GO-mf O-methyltransferase activity EnsemblGenomesN/AIEA
GO:0008171GO-mf O-methyltransferase activity JGI N/AIEA
PTHR10509Panther O-METHYLTRANSFERASE-RELATED JGI N/AIEA
PF01596PFAM O-methyltransferase JGI N/AIEA
PWY-1121SoyCyc9 suberin monomers biosynthesis Plant Metabolic Network ISS
PWY-361SoyCyc9 phenylpropanoid biosynthesis Plant Metabolic Network ISS
PWY-6039SoyCyc9 chlorogenic acid biosynthesis I Plant Metabolic Network ISS
PWY-6792SoyCyc9 scopoletin biosynthesis Plant Metabolic Network ISS
PWY-7498SoyCyc9 phenylpropanoids methylation (ice plant) Plant Metabolic Network ISS
GN7V-66006SoyCyc9-rxn caffeoyl-CoA O-methyltransferase Plant Metabolic Network ISS

Expression Patterns of Glyma.15g250900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.15g250900 not represented in the dataset
Glyma.15g250900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.15g250900 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma15g40151 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.15g250900
>Glyma.15g250900.1 sequence-type=CDS polypeptide=Glyma.15g250900.1.p locus=Glyma.15g250900 ID=Glyma.15g250900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAACGAGAAATATTTTGAACTGCTACTACAGCTGGTGAGGGTTGGAGGTCTTATTGTAATTGATAATGTCCTTTGGCATGGAAAAGTTGCTGACCCATTGGTAAATGACCCTAAAACTTTCAGCATTAGAAATTTTAATCAGAAGTTAATGGAAGACAAGCGTGTAAGCATCAGTATGGTACCTATTGGAGATGGGATGACAATCTGTCGAAAAAGATGA
Predicted protein sequences of Glyma.15g250900
>Glyma.15g250900.1.p sequence-type=predicted peptide transcript=Glyma.15g250900.1 locus=Glyma.15g250900 ID=Glyma.15g250900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MNEKYFELLLQLVRVGGLIVIDNVLWHGKVADPLVNDPKTFSIRNFNQKLMEDKRVSISMVPIGDGMTICRKR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo